Conserved Protein Domain Family
PRK13296

?
PRK13296: PRK13296 
CCA tRNA nucleotidyltransferase
Statistics
?
PSSM-Id: 106256
View PSSM: PRK13296
Aligned: 9 rows
Threshold Bit Score: 605.827
Threshold Setting Gi: 167627235
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
118498171   1 MKFYLVGGAVRDMLLGITPKDKDWVVVGATEDEMLANGFIKIAANFPVFIHPQTKQEYALARSEKKTANGYHGFEVNFSK 80 
167627235   1 MEFYLVGGAVRDILLGIAPKDRDWVVVGATETQMIKAGFTKILSSFPVFLHPETKEEYALARSEKKIAKGYHGFEVNFSS 80 
56707282    1 MKFYLVGGAVRDMLLGITPKDKDWVVVGATEDEMLANGFIKIAANFPVFIHPQTKQEYALARSEKKTASGYHGFEVNFSK 80 
110669752   1 MKFYLVGGAVRDMLLGITPKDKDWVVVGATEDEMLANGFIKIAANFPVFIHPQTKQEYALARSEKKTASGYHGFEVNFSK 80 
134301319   1 MKFYLVGGAVRDMLLGITPKDKDWVVVGATEDEMLANGFIKIAANFPVFIHPQTKQEYALARSEKKTASGYHGFEVNFSK 80 
89256942    1 MKFYLVGGAVRDMLLGITPKDKDWVVVGATEDEMLANGFIKIAANFPVFIHPQTKQEYALARSEKKTASGYHGFEVNFSK 80 
115315306   1 MKFYLVGGAVRDMLLGITPKDKDWVVVGATEDEMLANGFIKIAANFPVFIHPQTKQEYALARSEKKTASGYHGFEVNFSK 80 
156503132   1 MKFYLVGGAVRDMLLGITPKDKDWVVVGATEDEMLANGFIKIAANFPVFIHPQTKQEYALARSEKKTASGYHGFEVNFSK 80 
187931052   1 MKFYLVGGAVRDMLLGITPKDKDWVVVGATEDEMLANGFIKIAANFPVFIHPQTKQEYALARSEKKTASGYHGFEVNFSK 80 
118498171  81 YITLEDDLKRRDLTINSIAIDQNNKVIDPFNGQADLQNRILRHTSIAFIEDPLRVVRLARFKAQLSNFNFSIAEETLTLI 160
167627235  81 NITLEEDLKRRDLTINSMAIDKNNNIIDPFNGQNDIKNRILRHTSEAFIEDPLRVVRLARFKVQLSAFNFSIADETINII 160
56707282   81 YITLEDDLKRRDLTINSIAIDQNNKVIDPFNGQADLQNRILRHTSIAFIEDPLRVVRLARFKAQLSNFNFSIAQEMLALI 160
110669752  81 YITLEDDLKRRDLTINSIAIDQNNKVIDPFNGQADLQNRILRHTSIAFIEDPLRVVRLARFKAQLSNFNFSIAQEMLALI 160
134301319  81 YITLEDDLKRRDLTINSIAIDQNNKVIDPFNGQADLQNRILRHTSIAFIEDPLRVVRLARFKAQLSNFNFSIAQEMLALI 160
89256942   81 YITLEDDLKRRDLTINSIAIDQNNKVIDPFNGQADLQNRILRHTSIAFIEDPLRVVRLARFKAQLSNFNFSIAQEMLALI 160
115315306  81 YITLEDDLKRRDLTINSIAIDQNNKVIDPFNGQADLQNRILRHTSIAFIEDPLRVVRLARFKAQLSNFNFSIAQEMLALI 160
156503132  81 YITLEDDLKRRDLTINSIAIDQNNKVIDPFNGQADLQNRILRHTSIAFIEDPLRVVRLARFKAQLSNFNFSIAQEMLALI 160
187931052  81 YITLEDDLKRRDLTINSIAIDQNNKVIDPFNGQADLQNRILRHTSIAFIEDPLRVVRLARFKAQLCNFNFSIAQEMLALI 160
118498171 161 KELIKTGELNHLTRERLHIEFVKALNNPKIFFTTLEELEALKIIFPNISCILLLIPNKSFFENPIYKDSNINEKITLCLL 240
167627235 161 KSIIKSGELNYLTKERLHIEFIKALRNPKIFFETLDEFDSLRIIFPSIKKSLNAIPNNNFFRNKTYLNSSNEEKICLCLL 240
56707282  161 KELVKTGELNHLTRERLHIEFVKALNNPKIFFTTLKELEALKIIFPNISCFLPLIPNKSFFENPIYKGSNINEKITLCLL 240
110669752 161 KELVKTGELNHLTRERLHIEFVKALNNPKIFFTTLKELEALKIIFPNISCFLPLIPNKSFFENPIYKGSNINEKITLCLL 240
134301319 161 KELVKTGELNHLTRERLHIEFVKALNNPKIFFTTLKELEALKIIFPNISCILPLIPNKSFFENPIYKGSNINEKITLCLL 240
89256942  161 KELVKTGELNHLTRERLHIEFVKALNNPKIFFTTLKELEALKIIFPNISCILPLIPNKFFFENPIYKGSNINEKITLCLL 240
115315306 161 KELVKTGELNHLTRERLHIEFVKALNNPKIFFTTLKELEALKIIFPNISCILPLIPNKFFFENPIYKGSNINEKITLCLL 240
156503132 161 KELVKTGELNHLTRERLHIEFVKALNNPKIFFTTLKELEALKIIFPNISCILPLIPNKFFFENPIYKGSNINEKITLCLL 240
187931052 161 KELVKTGELNHLTRERLHIEFVKALNNPKIFFTTLKELEALKIIFPNISCILPLIPNKSFFENPIYKGSNINEKITLCLL 240
118498171 241 KVPQQKLDDIRKELLLTNKHYKLLKASIAISKILEDRNITAEEIFQLIKNANIIRDKNLFAESLNLYKKYLKVCDTITPH 320
167627235 241 NLGDDTINNLKLELLLTNKQLKLLIATSAIKKIIEFKSINAETALKIIKRANLLRDKKLQQNAIDIFEKYSEIDNSRFSH 320
56707282  241 KIPQQQLDDIRKEFLLTNKHYKLLKASIAISKILEDRSITAEEIFQLIKNANIIRDKNLFAESLNLYKKYLKICDTITPH 320
110669752 241 KIPQQQLDDIRKEFLLTNKHYKLLKASIAISKILEDRSITAEEIFQLIKNANIIRDKNLFAESLNLYKKYLKICDTITPH 320
134301319 241 KIPQQQLDDIRKELLLTNKHYKLLKASIAISKILEDRSITAEEIFQLIKNANIIRDKNLFAESLNLYKKYLKICDTITPH 320
89256942  241 KIPQQQLDDIRKELLLTNKHYKLLKASIAISKILEDRSITAEEIFQLIKNANIIRDKNLFAESLNLYKKYLKICDTITPH 320
115315306 241 KIPQQQLDDIRKELLLTNKHYKLLKASIAISKILEDRSITAEEIFQLIKNANIIRDKNLFAESLNLYKKYLKICDTITPH 320
156503132 241 KIPQQQLDDIRKELLLTNKHYKLLKASIAISKILEDRSITAEEIFQLIKNANIIRDKNLFAESLNLYKKYLKICDTITPH 320
187931052 241 KIPQQQLDDIRKELLLTNKHYKLLKASIAISKILEDRSITAEEIFQLIKNANIIRDKNLFAESLNLYKKYLKICDTITPH 320
118498171 321 RNYQLLQTTINTIKNASINSLtIETIPKDKLRNTLkqlyidiikKQLKL 369
167627235 321 TIIKQFKSALNIINTTNIETL-ITTVPKENLANAIktlymdiikKQLNL 368
56707282  321 RNYQLLQTTINTIKNASIDSLtIKTIPKDKLRNTL---------KQLKL 360
110669752 321 RNYQLLQTTINTIKNASIDSLtIKTIPKDKLRNTL---------KQLKL 360
134301319 321 RNYQLLQTTINTIKNASIDSLtIKTIPKDKLRNTL---------KQLKL 360
89256942  321 RNYQLLQTTINTIKNASIDSLtIKTIPKDKLRNTL---------KQLKL 360
115315306 321 RNYQLLQTTINTIKNASIDSLtIKTIPKDKLRNTL---------KQLKL 360
156503132 321 RNYQLLQTTINTIKNASIDSLtIKTIPKDKLRNTL---------KQLKL 360
187931052 321 RNYQLLQTTINTIKNASIDSLtIKTIPKDKLRNTL---------KQLKL 360
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap