Conserved Protein Domain Family
PRK13295

?
PRK13295: PRK13295 
cyclohexanecarboxylate-CoA ligase; Reviewed
Links
?
Statistics
?
PSSM-Id: 171961
View PSSM: PRK13295
Aligned: 18 rows
Threshold Bit Score: 859.356
Threshold Setting Gi: 111219685
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
111219685  12 AAGMRLFDPAEVQLFRAEGQWRHRTFLDDFLDHADSTPDKAAVVSYAKGRLLPETVTYGQLRAYVDRFAAALLDIGTGPG 91 
154244864   1 MEFDALLIEPRRAKMEAEGLWPGKTLLDYFDACRAEKPDATAVVSIVVGTGARRDLTYSEIDHLAWRAAVGLRRLGLGKD 80 
90422549    1 MEFDAILLPARRAESIARGHWHDRTINDDLDACVAACPDKTALAAVRLDGDQTRRFSYRELATLADRVAVGLSRLGVTRN 80 
91976023    1 MEFDAVLLPARRAESVARGFWHDRTINDDLDACVAACPDKTALTAVRLDRGEPRRFSYRELATLTDRVAVGLARLGVGRN 80 
119718515   1 MTFETILTAERIARHTADGHWLDRLITDYLDEHAEATPDRTAFVDAR------REMTYADLRREVDRCAHGLVELGVRPG 74 
91791063    1 -MIESQLSPQLVQQARAGGHWHNKTLLDFLDEVAPSRLDKVAVTDLNSMTGQANTLSYRQLLRLSKRIALGLAALGVQRG 79 
194292230   1 MDFDAVLIAPRRAASIAAGHWQDRTIHDYLAACVRDRPDAPALTALSIDRQHVTRFTRRELARMADRVAVGLSRLGIAAG 80 
116695632   1 MDFDAVLIAPRRAASIAARHWHDRTVNDYLAACVRDRPDAPALTALSLDSGSMTRFTWRELARMADRVAMGLSRLGIGAQ 80 
73537752    1 MDFDAVLIAPRRAASVAAGLWRDRTINDYFDATVARAPDGPALTSLQVESGAVRHFTWRQLDAMVTRIAVGLRRLGIERN 80 
154252218   1 -MFDPILTRKRVEAMNAGGFWPGKTAADYLDGCIAKMPDKTAVVDFNSMTNKATRLSYRDLGKIVERIAVGLAELGVEKG 79 
111219685  92 KVVSIQVANGWEGPALALATMRVGAVPNPIPIIYREHEVRHMLEEAGSAVYVAPQHFRGYDFAEMGARLHREIASLEHVY 171
154244864  81 DVLASQLPNGWEFVVLYIACRRLGIVFNPVMPIFREHELRFMLRHGEAKAFAIPRVFRGFDHEAMAETLKPELPDLSNLI 160
90422549   81 DVVAMQLPNGWQFSVLYLACSRIGAVLNPLMPIFRERELSFMLKHGEAKVLVVPKTFRNFDHEAMTRGLQPLLPALQQIV 160
91976023   81 DVVAMQLPNWWQFSILYLACSRIGAVLNPLMPIFRERELSFMLKHGEAKVLVVPKTFRNFDHEAMARGLQPSLPALQRIV 160
119718515  75 DVVSFQLPNWIEWVVVHYACTRIGAISNPLIPIYREREVGFMMGLARSRVLVVPRRFRDFDYPAMVERLRPDLPDLEHVL 154
91791063   80 DVVSYQLPNWWQFVALHLACLRIGAVTNPVMPIFRHHELTFMLGLAESKVMIVPREFRGFDHAAMLREIQPALPQLKHIF 159
194292230  81 DVVSCQLPNGWHLSVLYLACARLGAVLNPVMPIFRERELSFMLAHAQSKVVVVPKLFRGFDHAQMLRGLRDALPALRHVV 160
116695632  81 DVVSCQLPNGWHLTVLYLACSRLGAVLNPLMPIFRERELSFMLAHAQCKVAVVPQLFRGFGHAQMLQGLREALPALRHIV 160
73537752   81 DVVSCQLPNGWEVTALYLACARIGAVLNPLMPIFRERELSFMLAHADSKVVVVPQRFRGFDHAGMLAGLRDSLPALRHVV 160
154252218  80 DVVSCQLPNWWQFTALHLACVRIDAVTNPLMPIFRERELSFMLGLAESKVLVIPRTFRGFDYPAMVANIRAGLPQLRNVL 159
111219685 172 FINADDAVSselhFARHFIEPRRELD-PALGATLDSLRPGADDLAMLVFTSGTTGKPKAALHTFNTAWSGYRNvIVNALD 250
154244864 161 VVGGAGPNG----FEALLLDPAFDAEvSGIRQISARDRGDANDVCQLIYTSGTTGEPKGVMHTANTMYSNLVP-YAARLG 235
90422549  161 VVGGGGADD----FETLLTIPEWEKA-PDAPAILTNHRPGPDDITQLIYTSGTTGEPKGVMHSANTLMANIIP-YARRLK 234
91976023  161 VVDGGGADD----FDALLTIPEWEQQ-PDAQTILSSNRPGPDDITQLIYTSGTTGEPKGVMHSANTLMANIIP-YAERLR 234
119718515 155 VVDGDGADS----FETFLATP-WEE--RHDPGLLDSLRPDANDVTLLIFTSGTTGEPKGVMHTHNTVVAANAP-LPERLG 226
91791063  160 AIGGEGDMS----FEKHFIERRWEQEtPDADQVLAERRLRPDEVMQLLYTSGTTGEPKGALHTSNTHFANIVE-VVKRCG 234
194292230 161 VVDGDGDDS----FEALLSGPHWEDG-ADAAAILQRSRTGPDDVTQLIYTSGTTGEPKGVMHTANTLFSNIVA-YAGRLH 234
116695632 161 VAGGDGADS----FEALLSGPAWEYE-PDAANILLRSCPGPDDVTQLIYTSGTTGEPKGVMHSANTLFSNIVA-YAERLR 234
73537752  161 ITGSDGPDG----FEAMLCGADRDSD-PDAAAILRRDRPSPDDVTQLIYTSGTTGEPKGVMHTANTLLSNILP-YAERLR 234
154252218 160 VIGGDGETS----FEKVLLDTPWEQR-RDAGRLFAARRPDPDDVTQLMYTSGTTGEPKGVMHTSNTLLSNILV-CAERLG 233
111219685 251 LKSDDIAFMASTLGHLTGFIHGMLVPLSLGQKVVYQDQWDVDQMLDLLETEGLTWTLSATTFALDMVDAQKHRPRPLASk 330
154244864 236 LGASDVVLMASPMAHQTGFMYGLLMPVMLKARMVLLDSWDKALAAKVIAQDGVTFTMASTPFLMDLTNAVEELGTNSST- 314
90422549  235 LSQDDVILMASPMAHQTGFMYGLMMPIMLQASAVLQDVWEPAKAAELIRTERVSFTMASTPFLTDLTRVVKESALPVPS- 313
91976023  235 LGADDVILMASPMAHQTGFMYGLMLPIMLKASAVLQDVWDPAKAAELIRAEQVSFTMASTPFLADLTRVVKESAKSVPS- 313
119718515 227 VGADSVIHMASTLAHLTGFLYGARLPVQVGATGVLQDVWDPAEFVRLVEQHRITYTSAATPFLHDLVNVADLADHDLSS- 305
91791063  235 LTAEHVCFMPSPMAHQTGFAIGMELPLMLGAKMVLQDIWEPELALTRIQDEGVNFMMAATPFLADLTDHPDLPRYDIST- 313
194292230 235 LGGDDVVLMASPMAHQTGFMYGLMMPVMLGAHAVLQDIWDPVRAAALIRDEGVTFTMGSTPFLTDLARVVADSGVPVPS- 313
116695632 235 LTSDDVVLMASPMAHQTGFMYGLLMPVLLGAHAVLQDIWDPARAAALIREEGVTFTMGSTPFLTDLARVVAESGTPVPS- 313
73537752  235 LGAGDVVLMASPMAHQTGFMYGLMMPVVLGAHAVLQDIWNPVQAARLIRETGVTFTMGSTPFLTDLARTVEESGQPVPS- 313
154252218 234 LGADDVMFMASPMAHQTGFMYGLAMPVLAGATAILQDVWEPKRASASISREGITFTMASTPFLSDLTETVAADGSDVSR- 312
111219685 331 LRAFACGGASIPPGVAVDMDQIF-STSLVPLWGCSETGIASIHHLGAALDVLDASDGYPVPWQETRVVDDDLAPVPAGTI 409
154244864 315 LRIFLCAGTAIPGALVERARRVL-GTKIVSAWGMTENGAVTLVSPSDPDERSVNTDGFVLPGMEIQIRAADGTVLPAGQE 393
90422549  314 LKTFLCAGAPIPGPLVEQAQAGL-GAKIVSAWGMTENGAVTLITLDDDDKLASTTDGCPLPGVEVKVIDGDGAALPAGQI 392
91976023  314 LKTFLCAGAPIPGPLVEQAQIGL-GAKIVSAWGMTENGAVTLIKLDDDDKLASTTDGCALPGVEVRVVDGDGNALLAGEI 392
119718515 306 LQRFCCMGAPIPRAIVRRARAALpGLVVVGGWGQTENALVTLGVPGDPDEKLIETDGYPWPGMRIRVVDADGAEVPAGTE 385
91791063  314 LDVFISAGAPIPRTLVERATERL-KAHIVSAWGMTENILVTGTRLDDVPEKVFGTDGVPVPGMEIRVVDAAGQALAVDQE 392
194292230 314 LRIFLCAGAPIPGALVEQARQAL-GAKIVSAWGMTENGAVTTTLPEDSDERASTTDGCPLPGVAIRVVDGTDTDVPVGET 392
116695632 314 LRIFLCAGAPIPGALVERAREAL-GAKIVSAWGMTENGAVTTTLPDDSDERASTTDGCPLPGVEIRIVDGTDADVPPGET 392
73537752  314 LRTFLCAGAPIPGALVERARTAL-GASIVSAWGMSENGAVTTTLPDDSEERASTTDGLPLPGVEVKVVDAQDASVLAGEV 392
154252218 313 LRIFLVAGAPIPRALVERARQIL-GANIVSAWGMTENGLVTTTCLDDPDDKAINTDGRALPGMEVQVVDSENKPLPAGEE 391
111219685 410 GNLQVRGPGVFAGYFGREDLTLDAftADG-WYDTGDLGKVLPDGAIRIAGRSKDIIIRGGQNISAVEIESALYKHPEVQE 488
154244864 394 GALYVRGCSNFGGYLKRPQWNATD--AEG-WFDTGDIARIDDAGYIRICGRTKDVIIRGAENLPVVEIEAVLYKHPDIQQ 470
90422549  393 GRLVVRACSNFGGYLRRPQWNATD--AEG-WFDTGDLAYMTPAGYIRISGRSKDVIIRGGENIPVVEVEALLYKHPAVSQ 469
91976023  393 GRLVVRSCSNFGGYLKRPQWNGTD--ADG-WFDTGDLAYITAGGYIRISGRSKDVIIRGGENIPVVEVEALLYKHPAVAQ 469
119718515 386 GRLQVTGPFLFVGYAERLEMTRDS--FDGdWFDTGDLAHIDAEGYVSISGRTKDVIIRGGENIPVAYVENVLYENPKIEV 463
91791063  393 GELQSRGPSHFVGYLKRPERYDMD--DQG-WFKTGDLARIDADGCVRITGRAKDIIIRGGENVPVVEVEQMLHRHLAIQT 469
194292230 393 GRLLVRACSNFGGYLKRPQLNGTD--ADG-WFDTGDLARLDADGYLRIAGRSKDVIIRGGENIPVLEIETLLYRHPAVAQ 469
116695632 393 GRLLVRACSNFGGYLKRPQLNGTD--ADG-WFDTGDLARLDASGYLRIAGRSKDVIIRGGENIPVLEVETLLYRHPAVSQ 469
73537752  393 GRLLVRACSNFGGYLKRPQLNATD--AEG-WFDTGDLAKLDAEGYVRIAGRSKDVIIRGGENIPVVEIETLLYRHPAVAQ 469
154252218 392 GMLKARACSTFVGYLKRPDWYNHD--AEG-WFGTGDLARIDGQGYIRLTGRSKDIIIRGGENIPVVEIEGLLFRHPDIQD 468
111219685 489 VAVVAYPDERLGERVCAMVVPRPSgSSLTLENVARFLDAAGMAKPFWPQRLVLVDQLPRTPSGKVQKFVLRRELAdvlrE 568
154244864 471 VAIVAYPDERLGERACAFVVPKQG-KTFSFEEMVRFLDSQHLAKQYYPERLEVCDQLPSTASGKIQKFALRTMLReayeK 549
90422549  470 VAIVAYPDERLGERACAVVVLRTG-ETIDFRTMVEFLKTQKLAVQYIPERLIVREAMPATPSGKIQKFRLREMLQ----Q 544
91976023  470 VAIVAYPDERLGERACAVVVPRSG-GAIDFPAMVEFLKSQKLAVQYIPERLIVREAMPATPSGKIQKFRLREMLQ----Q 544
119718515 464 VAVVAVPDPRLQERACACVVLKPGvAGFDFAEMQEFLREKGVAKQYWPEFLTVLPELPKTPSGKIQKFHLRDQVA----Q 539
91791063  470 AAVVGVPDARLGERAVAYVTLRPG-HGLTFEQMKRFLEEQRMTKQYWPETLIVLDDLPRTPTGKIQKFRLREMAR----A 544
194292230 470 VAIVAYPDARLGERACAFVVPRAG-QSIDLDGMVDWLKQQKMALQYIPEKLVVRDALPATPAGKIQKFRLREMLV----G 544
116695632 470 VAIVAYPDERLGERACAFVVPRAG-QPFDQAAMVDWLKAQKMALQYIPEKLVVRDALPATPAGKIQKFRLREMLR----G 544
73537752  470 VAIVAYPDERLGERACAVVVPRQG-QGFDKPAMVDFLKAQKVALQYIPERLIVQDALPATPAGKIQKFRLREMLR----E 544
154252218 469 VAIVGVPDERLGERACAFIVPKPG-REVGLREVVAFLEEHRVARQYLPERAEIVGELPRTPSGKVQKFKLREIAV----A 543
111219685 569 EQA 571
154244864 550 SRA 552
90422549  545 NDL 547
91976023  545 NDL 547
119718515     ---    
91791063  545 ENK 547
194292230 545 DAG 547
116695632 545 DAS 547
73537752  545 QAA 547
154252218 544 LPA 546
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap