Conserved Protein Domain Family
PRK13250

?
PRK13250: PRK13250 
phycoerythrobilin:ferredoxin oxidoreductase; Provisional
Statistics
?
PSSM-Id: 139427
View PSSM: PRK13250
Aligned: 5 rows
Threshold Bit Score: 458.558
Threshold Setting Gi: 37520830
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
186681228   8 VTLYQPFLDYAIAYMRSRLDLEPYPIPTGFESNSAVVGKGKNQEEVVTTSYAFQTAKLRQIRAAHVQGGNSLQVLNFVIF 87 
113478370   8 VNLYQPFLDYALTKLKEELELQPYPIPSGFEHKVAMTGKGKKQQEVQTTSYAHCSPKLRQIRAAHVQGGSALQVLNFVIF 87 
37520830    1 MTLYEPFLERAQQVLTRRLELAPYPIPVGFERKEALV----RGEAVVTTSTAWQSPKLRQIRAAHVQGGGALQVLNFVIS 76 
218203943   1 MTLYQPFLDHAISLMQDQLSLQPYPIPEGFERKEEITGKGKRLERVITTSYAFKSPKLRQIRAAHVQGGSSLQVLNFVIF 80 
218442704   1 MSIYQPFLDYAITLLTEKLSLTPYPIPAGFERKEEMSGKGKKQETVVTTSYAYQAPKLRQIRAAHVQGGNALQVLNFVIF 80 
186681228  88 PHLNYDLPFFGADLVTLPGGHLIALDMQPLFRDDSAYQAKYTEPILPIFHAHQQHLSWGGDFPEEAQPFFSPAFLWTRPQ 167
113478370  88 PHLNYDLPFFGADLVSLPGGHLIALDMQPLFRDNLQYQKKYTEPIWETFQKHQKYLPWGGDFPEEATPFFSPAFLWTRPQ 167
37520830   77 PRLEYDLPFFGADLVTLPGGHLIALDMQPLFRDDPAYQAKYTEPIVPLFEAHRAHLEWGGDFPEEARPFFSPAFLWTRPK 156
218203943  81 PQLTYDLPFFGADLVTLPGGHLIALDMQPLFHDQ-AYQQQYTEPILALFKSYQQHLPWGGDFPEEAKPFFSPAFLWTRPQ 159
218442704  81 PDLNYDLPFFGADLVTLPGGHLIAIDMQPLFHNA-AYQHKYSDPILPLFNAYQAHLPWGGDFPDDAKPFFSPAFLWTRPQ 159
186681228 168 ETAVVETQVFAAFKDYLKAYLDFVEQAEAVTDSQNLVAIKQAQLRYLRYRAEKDPARGMFKRFYGAEWTEEYIHGFLFDL 247
113478370 168 KTELVETRVFEAFKDYLQAYLIFVKQTEQITNSEKLAEIKEAQLRYLRYRAEKDPARKMLTRFYGHEWTEEYIHGFLFDL 247
37520830  157 ETGTVETRVFAAFVDYLNAYLDFVERAEPVTHPEGLAAVERAQLRYLHYRAEKDPARGMFRRFYGPEWTEEYIHGFLFDL 236
218203943 160 ETEVVVTRVFEAFKDYLQAYLNFVEQAKLITDSQRLEEILQAQRRYIAYRANKDPARGMFTRLYGKAWTEEYIHGFLFDL 239
218442704 160 ETEVVKTRVFEAFKDYLGAYLQFVEQAEAVKKPEQLKEILASQRRYIGYRAAKDPARGMFTRFYGEEWTEEYIHGFLFSL 239
186681228 248 ERKLTVVK 255
113478370 248 ERKLALNP 255
37520830  237 ERRREAVH 244
218203943 240 ERQLVAIS 247
218442704 240 LTTPSR-- 245
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap