Conserved Protein Domain Family
PRK13249

?
PRK13249: PRK13249 
phycoerythrobilin:ferredoxin oxidoreductase; Provisional
Statistics
?
PSSM-Id: 139426
View PSSM: PRK13249
Aligned: 12 rows
Threshold Bit Score: 488.463
Threshold Setting Gi: 33241197
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148238817   2 SSLVRTSSLDPVQIKGWRWQPFLDKAISALETFRLSPYPIDETFLQREGSTGSKSKPVPVTTATWACATDKLRQVRCACV 81 
113954259   1 MTIQRLKSTDPVSIEGWSWQPFLEDAIKSLGGLNFEPYPVPDRFLQREDQTGSKSKPISVTTATWACKTEKFRQVRAACV 80 
33866553    2 SIDLRASSLDPVQIPGWRWQPFLDEASAALKPFNPSPYPIAETFLQKEGSTGSKAKPVPVTTATWACSTDKLRQVRCACV 81 
78211974    2 TLPLRTTSLDPVQIPGWRWQPFLDTAVAALSSLQPDPYPIAERFLQKEGSTGSKAKPVPVRTATWACSTEKLRQVRCACV 81 
148243161   1 MTTPRQSSLEPLSIANWRWQPFLDHACGALQPLELEPYPVAPEFLLQTSQTGSKSKPVQVTTATWACKTNKLRQVRAACV 80 
78185473    1 MTTTRHSSTDSVNIPGWGWQPFLEDAVQALQPLNLEPYPVANDFLYKQDQTGSKAKPITVTTATWACKTDKFRQVRAACV 80 
72383005    1 MQIIRNNSQDPISISNWRWACFLDETIKAFSTFQTRPYQIDNDFLFRESFFGSSSNPKKVILETWGLKMEKIRQARCACL 80 
124023937   1 MKPLRLSSLDPVRMPEWRWAPFLSHAINALIPLKPEPYPVAPEFLQREGKTGSKSQPIKVTTCTWACRTKKFRQVRAACV 80 
33863954    1 MKPSRLSSLDPVKMPEWRWAPFLSHAINAFIPLKPEPYPVAPEFLQREGKTGSKSQPIRVTTCTWACRTKKFRQVRAACV 80 
159904254   1 MKRERNNSLDPLEISEWRWSEFLDDAIKALELFDIEPYPIPEEFLTKEETIKFKNNQIKVKALTWACRTTKIRQARAACI 80 
124026747   1 MQIIRNNSQDPISISNWRWACFLDETIKAFSTFQTRPYQIDNDFLFRESFFGSSSNPKKVILETWGLKMEKIRQARCACL 80 
33241197    1 MIIKRDNSLSKIDLRDWIWTPFFNDLVDKLSVFEIEPYPVSHDFLSKESITGSRRNPVHVTTLTWAAKFEKIKQVRLACI 80 
148238817  82 EAGTAASVLNFVINPSCRFDLPFFGADLVTLPNGHLLALDLQPVDKADPEHTGPVWERLMPVFERWQAELPDGGPIPEEA 161
113954259  81 SAGSAASVLNFVINPNSTYDLPFFGGDLVTLPSGHLLALDLQPAIKTDEVHTTHVWDQLIPIFERWRDQLPYGGPIPEEA 160
33866553   82 EAGMAASVLNFVINPSCRFDLPFFGADLVTLPNGHLLALDLQPVDKADPDHTQPVWERLMPLFERWQAELPDGGPIPEEA 161
78211974   82 EAGAAASVLNFVINPSSRFDLPFFGADLVTLPNGHLLALDLQPVDKTDPDHTGPVWQRLMPLFERWRAQLPDGGPIPEEA 161
148243161  81 EAGAAASVLNFVVNPSTSYDLPFFGADLVTLPAGHLLALDLQPALKTDAEHTKAVWERLMPIFERWQQRLPGGGPIPEEA 160
78185473   81 YGGTAASVLNFVINPSARFDLPFFGGDLVTLPSGHLLALDLQPADKSDEAHTQQVWEKLIPIFERWRSKLPDGGPIPEEA 160
72383005   81 QAGEITSVMNLVISPLNNYDLPFFGADFVTLPNGHLIALDLQPALKDDINHTQHVWNKLKPIHAHWQSKIPSGGDIPSDA 160
124023937  81 EAGSSASVLNFVINPYHTFDLPFFGADLVTLPSGHLLALDLQPAITSDERHTKQVWERLMPIFEQWRVRLPEGGPIPEEA 160
33863954   81 EAGRSASVLNFVINPYHTFDLPFFGADLVTLPSGHLLALDLQPAITSDERHTKQVWERLMPIFEHWRVHLPEGGPIPEEA 160
159904254  81 EAGPAASVLNLVINPFHNFELPFFGADFVTLPSGHLLALDLQPVLKKDEIHNQKVWSKLIPIHDHWQSLLPSGGPIPQEA 160
124026747  81 QAGEITSVMNLVISPLNNYDLPFFGADFVTLPNGHLIALDLQPALKDDINHTQHVWNKLKPIHAHWQSKIPTGGDIPSDA 160
33241197   81 KGGESLSVFNLLIHPLNDYDLPFFGADFVTLPNGHLLALDLQPALKLDNIHTENVWPRLIPLHDHWQSLLPSGGEIPKEA 160
148238817 162 QPYFSPAFLWTRIPLGEEGDALIERVIRPAFIEYLQLYLKLVAEAQPVNDDRAASLLAGQKRYTAYRAEKDPARGMLTRF 241
113954259 161 QPFFSPGFLWTRLPLGEEGDDLIQSVVRPAFNEYLELYLQLAASAERVNAERSDFLLQGQRKYTDYRAEKDPARGMLTRF 240
33866553  162 QPYFSPAFLWTRIPLGEEGDELIERVIRPAFIDYLQLYLNLVAEAEPVSDDRAELLLSGQKRYTAYRAEKDPARGMLTRF 241
78211974  162 QPYFSPAFLWTRIPLGEEGDALIDRVIRPAFADYLQLYLALVEEAQPVDHERAAHLLLGQKRYTAYRAEKDPARGMLTRF 241
148243161 161 KPYFSPGFLWTRIPLGSEGDALIEEAVKPAFRDYLELYLQLVHEAEEVSPERSAELLAGQKRYTSYRAEKDPARGMLTRF 240
78185473  161 QPFFSPGFLWTRLPLGDEGDQLINSVVRPAFNDYLSLYLELAEAAKPVGDDRRDHLLKGQRRYTDYRAEKDPARGMLTRF 240
72383005  161 RQYFSPAFLWSRIPLGEEGDNLITQTIKPAFDEYLNCFFDLLRDAKITSKERSFQLLNGQKKYMRYRAEKDPARGMLRSF 240
124023937 161 KPYFSPGFLWTRLHLGSEGNQLIDEVIMPAFRDYLNLYLDLVEMAEEVSPQRAFKLLEGQKRYLSYRGKKDPARAMLARF 240
33863954  161 KPYFSPGFLWTRLPLSIEGNQLIDEVIMPAFKDYLNLYLDLVEMAEEVSPQRAFKLLEGQKRYLSYRAKKDPARAMLARF 240
159904254 161 ETFFSPGFLWTRLPLDDQGSKLISKVIRPAFQEYLTLYIDLISDAQEVSKERSLEILSGQKAYINYRAEKDPARGMLARF 240
124026747 161 RQYFSPAFLWSRIPLGEEGDNLITQTIKPAFDEYLNCFFDLLRDAKITSKERSFQLLNGQKKYMRYRAEKDPARGMLRSF 240
33241197  161 EPYFSPGFLWSRLPLSKESDNIISEILRPAFGEYLSLYIELLHIAKPLKKERALKILEGQKAYINYRSTKDPARAMLCRF 240
148238817 242 YGSEWTESYIHDVLFDL 258
113954259 241 HGSEWTEAYIHTVLFDL 257
33866553  242 YGSEWTESYIHGVLFDL 258
78211974  242 YGSEWTESYIHGVLFDL 258
148243161 241 HGAEWTEAYIHGVLFDL 257
78185473  241 HGSDWTEKYIHTVLFDL 257
72383005  241 FGEVWTESYINNILFDL 257
124023937 241 HGHQWTESYIHNVLFDL 257
33863954  241 HGHQWTESYIHNVLFDL 257
159904254 241 FGKDWTEQYIHKVLFDL 257
124026747 241 FGEVWTESYINNILFDL 257
33241197  241 YGKEWTEDYIHKVLFNI 257
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap