Conserved Protein Domain Family
PRK13248

?
PRK13248: PRK13248 
phycoerythrobilin:ferredoxin oxidoreductase; Provisional
Statistics
?
PSSM-Id: 139425
View PSSM: PRK13248
Aligned: 6 rows
Threshold Bit Score: 461.327
Threshold Setting Gi: 33862148
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
78780069    1 MLIEDTIFYRPDWKWHNFLKYLVNNLSKYNCLEKKIPSEYSYKDSTYGSKKSKKNVNLSTWGVTHKKRIQFARAVCINSP 80 
157414198   1 MLIKDTIFYRPDWRWHIFLKYLTNNLSKYNCLEKIIPSEYSYKDSTYGSKKSKKNVNLCTWGVTHKKRIQFARAVCINSP 80 
123969333   1 MLIQDTIFYRPDWRWHNFLKYLTNNLSKYNCLEKTIPSEYSYKDSTYGSKKSKKNVNLSTWGVTHKKRIKFARAVCINSP 80 
123967012   1 MLIQNTIFYKKEWRWSNFIKLLISQLAKYHCLEHEIPSAFSYKESTYGSSKSQNNVSLFTWGATHRERINFARAVCINSP 80 
126697122   1 MLIQDTIFYRPDWRWHNFLKYLTNNLSKYNCLEKKIPSEYSYKDSTYGSKKLKKNVNLSTWGVTHKKRIQFARAVCINSP 80 
33862148    1 MLIQNTIFYSQEWRWAKFIKFLISQLDNYHCVEHKIASDFSYKESSYGSKKSKKNINLFTWGATHQKRINFARAVCINSP 80 
78780069   81 NYSVLNFLIIPNTIYNVPFFGVDFVSLPNSHLLVLDFQPSLKIQNQYNNELLEKLIKLKNHCHSSLPLAEKMSADVARFF 160
157414198  81 KYSVLNFLIIPNTIYNVPFFGVDFVSLPNIYLLVLDFQPSLKIQNQYNNQLLEKLIKLKNHCHSSLPLAEEMSVDVARFF 160
123969333  81 NYSVLNFLIIPNTIYNVPFFGVDFVSLPNSYLLVLDFQPSLKIQNQYNNDLLEKLIKLKNHCHSSLPLAEKMSADVARFF 160
123967012  81 SYSVLNFLIIPSTRFNIPFLGVDFVSLPKNHLLVLDFQPSLKVENQFNSELLDQLVKLKKSCHKSLPIAEKMSEEVSRFF 160
126697122  81 NYSVLNFLIIPNTIYNVPFFGVDFVSLPNSHLLVLDFQPSLKIQKQYNNELLEKLIKLKNHCHSSLPLAEKMSADVARFF 160
33862148   81 NYSVLNFLIIPKTSYNIPFLGVDFVSLPTSHLLVLDFQPSLKVENQFNSELLEQIIKLKKSCHSSLPVAEKMSEDVAKFF 160
78780069  161 SPGVIWSKLPKEERSDFLIANQLYTSFKEYLDLYLEILFESQQVNLNLQKELINGQNNYLKYRIDNDPARPMLSSLFGKE 240
157414198 161 SPGAIWSKLPKEERSDFLIANQLYTSFKEYLDLYLEILFESKEVNIDLQKELINGQNNYLNYRRDNDPARPMLSSLFGKE 240
123969333 161 SPGVIWSKLPKEERSDFLITNQLYTSFKEYLDLYLEILFESKEVNIELQKELTNGQINYLNYRRDNDPARPMLSSLFGQE 240
123967012 161 SPGLIWSRLPKHKNSDYLIENQLYHSFKEYLVLYLNTLFTSEEVDQGLQQEIINGQNNYLNYRRNKDPARPMLSSLFGKD 240
126697122 161 SPGVIWSKLPKEERSDFLITNQLYTSFKEYLDLYLEILFESKEVNLELQKELINGQNEYLNYRRDNDPARPMLSSLFGKE 240
33862148  161 SPGLIWSRLAKHQDSDNLIENQLYDSFKEYLNLYLKTLFESEEVGHGLQQELINGQNDYLNYRRDNDPARPMLSSLFGKD 240
78780069  241 FTESLIKEVLFTT 253
157414198 241 FTESLIKEVLFTT 253
123969333 241 FTESLIEEVLFTT 253
123967012 241 FTESLINKVLFST 253
126697122 241 FTESLIEEVLFTT 253
33862148  241 FTESLINKVLFST 253
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap