Conserved Protein Domain Family
ureA

?
PRK13242: ureA 
urease subunit gamma; Provisional
Statistics
?
PSSM-Id: 139420
View PSSM: PRK13242
Aligned: 10 rows
Threshold Bit Score: 177.961
Threshold Setting Gi: 161619301
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
82700175    1 MHLTPREFDKLVIHMLSDVALKRKNKGLKLNHPEAVAVLSAYVLDGAREGKTVEEVMDGARSVLKADDVMDGVPDLLPLI 80 
189024485   1 MHLTPREFDKLVIHMLSDVALKRKNKGLKLNHPEAVAVLSAYVLDGAREGKTVEEVMDGARSVLKADDVMDGVPDLLPLI 80 
148559171   1 MRLTPREFDKLVIHMLSDVALKRKNKGLKLNHPEAVAVLSAYVLDGAREGKTVEEVMDGARSVLKADDVMDGVPDLLPLI 80 
23502228    1 MHLTPREFDKLVIHMLSDVALKRKNKGLKLNHPEAVAVLSAYVLDGAREGKTVEEVMDGARSVLKADDVMDGVPDLLPLI 80 
62290252    1 MHLTPREFDKLVIHMLSDVALKRKNKGLKLNHPEAVAVLSAYVLDGAREGKTVEEVMDGARSVLKADDVMDGVPDLLPLI 80 
161619301   1 MHLTPREFDKLVIHMLSDVALKRKNKGLKLNHPEAVAVLSAYVLDGACEGKTVEEVMDGARSVLKADDVMDGVPDLLPLI 80 
256369772   1 MHLTPREFDKLVIHMLSDVALKRKNKGLKLNHPEAVAVLSAYVLDGAREGKTVEEVMDGARSVLKADDVMDGVPDLLPLI 80 
17986932    1 MHLTPREFDKLVIHMLSDVALKRKNKGLKLNHPEAVAVLSAYVLDGAREGKTVEEVMDGARSVLKADDVMDGVPDLLPLI 80 
225852839   1 MHLTPREFDKLVIHMLSDVALKRKNKGLKLNHPEAVAVLSAYVLDGAREGKTVEEVMDGARSVLKADDVMDGVPDLLPLI 80 
163843614   1 MHLTPREFDKLVIHMLSDVALKRKNKGLKLNHPEAVAVLSAYVLDGAREGKTVEEVMDGARSVLKADDVMDGVPDLLPLI 80 
82700175   81 QVEAVFSDGSRLVSLHNPIT 100
189024485  81 QVEAVFSDGSRLVSLHNPIT 100
148559171  81 QVEAVFSDGSRLVSLHNPIT 100
23502228   81 QVEAVFSDGSRLVSLHNPIT 100
62290252   81 QVEAVFSDGSRLVSLHNPIT 100
161619301  81 QVEAVFSDGSRLVSLHNPIT 100
256369772  81 QVEAVFSDGSRLVSLHNPIT 100
17986932   81 QVEAVFSDGSRLVSLHNPIT 100
225852839  81 QVEAVFSDGSRLVSLHNPIT 100
163843614  81 QVEAVFSDGSRLVSLHNPIT 100
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap