Conserved Protein Domain Family
nifH

?
PRK13232: nifH 
nitrogenase reductase; Reviewed
Statistics
?
PSSM-Id: 106194
View PSSM: PRK13232
Aligned: 3 rows
Threshold Bit Score: 507.999
Threshold Setting Gi: 21226821
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
73667721   1 MRQIAIYGKGGIGKSTTTQNLTASLSTMGNKIMLVGCDPKADSTRMLLGGLNQKTVLDTLRSEGDEGVDLDVVMQRGFGD 80 
21226821   1 MRQIAIYGKGGIGKSTTTQNLTAALATMGNKILLVGCDPKADSTRMLLGGLNQKTVLDTLRSEGDEGVNLDVVVQPGFGN 80 
20092691   1 MRQIAIYGKGGIGKSTTTQNLTAALSTMGNNILLVGCDPKADSTRMLLGGLNQKTVLDTLRSEGDEGIDLDTVLQPGFGG 80 
73667721  81 IKCVESGGPEPGVGCAGRGIITSIGLLENLGAYTDDLDYVFYDVLGDVVCGGFAMPIREGKAKEIYIVASGELMAIYAAN 160
21226821  81 IKCVESGGPEPGVGCAGRGIITSIGLLENLGAYTEDLDYVFYDVLGDVVCGGFAMPIREGKAKEIYIVASGELMAIYAAN 160
20092691  81 IKCVESGGPEPGVGCAGRGIITSIGLLENLGAYTDDLDYVFYDVLGDVVCGGFAMPIREGKAKEIYIVASGELMAIYAAN 160
73667721 161 NICKGLAKFAKGGARLGGIICNSRNVDGERELLDAFAKKLGSQLIHFIPRDNIVQRAEINRKTVIDFDPESNQAKEYLTL 240
21226821 161 NICKGLAKFAKGGARLGGIICNSRNVDGERELLEAFAKKLGSQLIHFVPRDNIVQRAEINRKTVIDFDPESNQAKEYLTL 240
20092691 161 NICKGLAKFAKGGARLGGIICNSRKVDGERELLEAFAKKLGSHLIHFVPRDNIVQRAEINRKTVIDFDRESDQAKEYLTL 240
73667721 241 AHNVQNNDKLVVPTPLPMEELESMMVEFGIVDM 273
21226821 241 ASNVQNNTKLVVPTPLPMEELEAMMVEFGIVEL 273
20092691 241 ADNVQNNNKLVVPTPLPMEELEAMMVEFGIVEL 273
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap