Conserved Protein Domain Family
PRK13223

?
PRK13223: PRK13223 
phosphoglycolate phosphatase; Provisional
Statistics
?
PSSM-Id: 171912
View PSSM: PRK13223
Aligned: 15 rows
Threshold Bit Score: 486.293
Threshold Setting Gi: 152986126
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116054336   1 MSAAEPFFATRLPRLVMFDLDGTLVDSVPDLTAAVDSMLASLGRPPAGIEKVRQWIGNGARVLVRRALAGSIEHDGIGEE 80 
15595805    1 MSAAEPFFATRLPRLVMFDLDGTLVDSVPDLTAAVDSMLASFGRPPAGIEKVRQWIGNGARVLVRRALAGSIEHDGIGEE 80 
218889349   1 MSAAEPFFATRLPRLVMFDLDGTLVDSVPDLTAAVDSMLASLGRPPAGIEKVRQWIGNGARVLVRRALAGSIEHDGIGEE 80 
77461340    1 MSGFEQLFPGQLPRLVMFDLDGTLIDSVPDLAAAVDNMLLSLGRKPAGIESVREWVGNGAPVLVRRALAGGIDHSSVDDV 80 
229592938   1 MSGFEQLFPGKLPRLVMFDLDGTLIDSVPDLAAAVDEMLLKLGRKPAGVDSVREWVGNGVQMLVRRALADHIDAEGVDEV 80 
70732918    1 MSAFEQLFQGRLPRLVMFDLDGTLVDSVPDLAAAVDQMLLKLGRKPAGVEAVREWVGNGAPMLVRRALANSLEAQGVDDV 80 
170723943   1 MSGFEQLFPGTLPRLVMFDLDGTLIDSVPDLAAAVDRMLLELGRPAAGLDAVRHWVGNGAPVLVRRALAGGLDHATVDDE 80 
71736708    1 -----------MPKLVMFDLDGTLVDSVPDLAVAVDTMLAELGRPIAGLESVRAWVGNGAPVLVRRALANHLDHSGVDDE 69 
66047837    1 MSGFEQLFAGKLPKLIMFDLDGTLVDSVPDLAVAVDTMLAELGRPIAGLESVRAWVGNGAPVLVRRALANNLDHSGVDDA 80 
28867795    1 ------MFAGKLPKLIMFDLDGTLVDSVPDLAVAVDTMLAELGRPTAGLESVRAWVGNGAPVLVRRALANNLDHSGVDEA 74 
116054336  81 ETEAALALFMEAYADSHALTEVYPGVVDTLKWLKRNGVEMALITNKPERFVAPLLDEMKLGRYFRWIIGGDTLPQQKPDP 160
15595805   81 ETEAALALFMEAYADSHALTEVYPGVVDTLKWLKRNGVEMALITNKPERFVAPLLDEMKLGRYFRWIIGGDTLPQQKPDP 160
218889349  81 ETEAALALFMEAYADSHALTEVYPGVVDTLKWLKRNGVEMALITNKPERFVAPLLDEMKLGRYFRWIIGGDTLPQQKPDP 160
77461340   81 EAEHALEVFMEAYGASHELTVVYPGVRDTLKWLHKQGVAMALITNKPERFVAPLLDQMKIGRYFKWIIGGDTLPQKKPDP 160
229592938  81 EAEHALELFNAAYEDGHELTVVYPGVRDTLKWLSKQGVEMALITNKPERFVAPLLDQMKIGRYFRWIIGGDTLPQKKPDP 160
70732918   81 EAEYALELFNTAYEDSHELTVVYPGARETLKWLHKQGVEMALITNKPERFVAPLLDQMKIGRYFRWIIGGDTLPQKKPDP 160
170723943  81 LAERGLALFMEAYAESHDLTVVYPGVHDTLRWLRKQGVEMALITNKPERFVAPLLDQMKIGRYFRWIIGGDTLPQKKPDP 160
71736708   70 LAEQGLEIFMRAYAQKHEFTVVYPGVRETLKWLQKMGVEMALITNKPERFVAPLLDEMKLGRFFRWIIGGDTMPQKKPDP 149
66047837   81 LAEQGLEIFMRAYAQKHEFTVVYPGVRETLKWLQKMGVEMALITNKPERFVAPLLDEMKLGRFFRWIVGGDTMPQKKPDP 160
28867795   75 LAERGLDIFMRAYAEKHEFTVVYPGVRETLKWLQKMGVEMALITNKPERFVAPLLDEMKLGRFFRWIIGGDTMPQKKPDP 154
116054336 161 AALLFVMKMAGIEPEDALFVGDSRNDVLAAKAAGVRCAALTYGYNHGRPIAEEAPTLVIDNLRDLLP-CADQAAEIVLPD 239
15595805  161 AALLFVMKMAGIEPEDALFVGDSRNDVLAAKAAGVRCAALTYGYNHGRPIAEEAPTLVIDNLRDLLP-CADQAAEIVLPD 239
218889349 161 AALLFVMKMAGIEPEDALFVGDSRNDVLAAKAAGVRCAALTYGYNHGRPIAEEAPTLVIDNLRDLLP-CADQAAEIVLPD 239
77461340  161 AALFFVMKMSGIPASQSLFVGDSRSDVLAAKAAGVKCVGLSYGYNHGRPIAEESPTLVIDDLRKLIPgCLDTAAEITLPD 240
229592938 161 AALFFVMKMANIPASQSLFVGDSRSDVQAAKAAGVQCVALSYGYNHGRPIAEESPAMVIDDLRLLIPgCLGAGAEITLPD 240
70732918  161 AALFFVMKMASVPASQSLFVGDSRSDVLAAKAAGVKCVALSYGYNHGRPIAEESPALVIDNLRALIPgCLEPAAEITLPD 240
170723943 161 AALLFVMKMAGVKPGQALFVGDSRSDVLAAKAAGVQCVGLSYGYNHGRPIDEEAPSLVIGDLRLLLPgCVVTDTGITLAD 240
71736708  150 AALFFVMKMAGVPASQALFVGDSRSDVQAAKAAGVACVALSYGYNHGRPIAEENPAMVIDDLRKLIPgCLDMDAEILLPD 229
66047837  161 AALFFVMKMAGAPASQSLFVGDSRSDVQAAKAAGVACVALSYGYNHGRPIAEENPAMVIDDLRKLIPgCLDMDAEILLPD 240
28867795  155 AALFFVMKMAGVPASQSLFVGDSRSDVQAAKAAGVACVALSYGYNHGRPIAEENPAMVIDDLRRLIPgCLDLDAEILLPD 234
116054336 240 dsLSPSDQRDQAVAVS-KLWMKVIKALARWRWRA 272
15595805  240 dsLSPSDQRDQAVAVS-KLWMKVIKALARWRWRA 272
218889349 240 dsLSPSDQRDQAVAVS-KLWMKVIKALARWRWRA 272
77461340  241 --AAQSPSGNAIVVVTrKLWMKVIKALARWRWRA 272
229592938 241 --TDPSPSGNSIVVVTrKLWMKVIKALARWRWRA 272
70732918  241 --AVPSHSGNSIVVVTrKLWMKVIKALARWRWRA 272
170723943 241 --LQASQDREPTVVVTgKFWMKVIKALARWRWRA 272
71736708  230 --INSPSSRESIVVVTrKLWMKVIKALARWRWRA 261
66047837  241 --IKRPSSRESIVVVTrKLWMKVIKALARWRWRA 272
28867795  235 --IKRPSSRESIVVVTrKLWMKVIKALARWRWRA 266
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap