Conserved Protein Domain Family
ureB

?
PRK13205: ureB 
urease subunit beta; Reviewed
Statistics
?
PSSM-Id: 106174
View PSSM: PRK13205
Aligned: 3 rows
Threshold Bit Score: 296.714
Threshold Setting Gi: 62388980
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
62388980    1 MIPGEYILSSESLTGNVGREAKTIEIINTGDRPVQIGSHFHFAEVNPSISFDRSEGYGFRLDIPSGTAVRLEPGDARTVN 80 
19551335    1 MIPGEYILSSESLTGNVGREAKTIEIINTGDRPVQIGSHFHFAEVNPSISFDRSEGYGFRLDIPSGTAVRLEPGDARTVN 80 
145294146   1 MIPGEYILSSESLTGNVGREAKTIEIINTGDRPVQIGSHFHFAEVNPSISFDRSEGYGFRLDIPSGTAVRLEPGDARTVN 80 
62388980   81 LVAIGGDRIVAGFRDLVDGPLEDLKVNVWEGREDGWRRSSAAGDAPQELPQVEAAERGRKLDDATDVDTNVGTEEGFEEG 160
19551335   81 LVAIGGDRIVAGFRDLVDGPLEDLKVNVWEGREDGWRRSSAAGDAPQELPQVEAAERGRKLDDATDVDTNVGTEEGFEEG 160
145294146  81 LVAIGGDRIVAGFRDLVDGPLEDLKVNVWEGREDDWRRSSAAGDAPQELPQVEAAERGRKLDEATD----VGTEDTPEEG 156
62388980  161 RN 162
19551335  161 RN 162
145294146 157 QN 158
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap