Conserved Protein Domain Family
ureB

?
PRK13204: ureB 
urease subunit beta; Reviewed
Links
?
Statistics
?
PSSM-Id: 171902
View PSSM: PRK13204
Aligned: 10 rows
Threshold Bit Score: 321.723
Threshold Setting Gi: 225852840
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
82700176    1 MAKEPTEAAHPQPEQTKTNHKAHRPVGGYVLAKDPIEINQGRPRTTLTVRNTGDRPIQIGSHFHFFEVNRYLEFDRSKAF 80 
189024486   1 MAKEPTEAAHPQPEQTKTNHKAHRPVGGYVLAKDPIEINQGRPRTTLTVRNTGDRPIQIGSHFHFFEVNRYLEFDRSKAF 80 
148560066   6 MAKEPTKAAHPQPEQTKTNHKAHRPVGGYVLAKDPIEINQGRPRTTLTVRNTGDRPIQIGSHFHFFEVNRYLEFDRSKAF 85 
23502229    1 MAKEPTKAAHPQPEQTKTNHKAHRPVGGYVLAKDPIEINQGRPRTTLTVRNTGDRPIQIGSHFHFFEVNRYLEFDRSKAF 80 
62290253    1 MAKEPTEAAHPQPEQTKTNHKAHRPVGGYVLAKDPIEINQGRPRTTLTVRNTGDRPIQIGSHFHFFEVNRYLEFDRSKAF 80 
161619302   1 MAKEPTKAAHPQPEQTKTNHKAHRPVGGYVLAKDPIEINQGRPRTTLTVRNTGDRPIQIGSHFHFFEVNRYLEFDRSKAF 80 
256369773   1 MAKEPTKAAHPQPEQTKTNHKAHRPVGGYVLAKDPIEINQGRPRTTLTVRNTGDRPIQIGSHFHFFEVNRYLEFDRSKAF 80 
17986931    1 MAKEPTEAAHPQPEQTKTNHKAHRPVGGYVLAKDPIEINQGRPRTTLTVRNTGDRPIQIGSHFHFFEVNRYLEFDRSKAF 80 
225852840  19 GQGKPTEAAHPQPEQTKTNHKAHRPVGGYVLAKDPIEINQGRPRTTLTVRNTGDRPIQIGSHFHFFEVNRYLEFDRSKAF 98 
163843615   1 MAKEPTKTAHPQPEQTKTNHKAHRPVGGYVLAKDPIEINQGRPRTTLTVRNTGDRPIQIGSHFHFFEVNRYLEFDRSKAF 80 
82700176   81 GLRLDIPANTAVRFEPGDEKEVTLVPFAGKRFIFGFNNLVDGWSGDGPTPDYQPNREIAAERAEKLGFKSCKSGGKDAK 159
189024486  81 GLRLDIPANTAVRFEPGDEKEVTLVPFAGKRFIFGFNNLVDGWSGDGPTPDYQPNREIAAERAEKLGFKSCKSGGKDAK 159
148560066  86 GLRLDIPANTAVRFEPGDEKEVTLVPFAGKRFIFGFNNLVDGWSGDGPTPDYQPNREIAAERAEKLGVKSCKSGGKDAK 164
23502229   81 GLRLDIPANTAVRFEPGDEKEVTLVPFAGKRFIFGFNNLVDGWSGDGPTPDYQPNREIAAERAEKLGFKSCKSGGKDAK 159
62290253   81 GLRLDIPANTAVRFEPGDEKEVTLVPFAGKRFIFGFNNLVDGWSGDGPTPDYQPNREIAAERAEKLGFKSCKSGGKDAK 159
161619302  81 GLRLDIPANTAVRFEPGDEKEVTLVPFAGKRFIFGFNNLVDGWSGDGPTPDYQPNREIAAERAEKLGFKSCKSGGKDAK 159
256369773  81 GLRLDIPANTAVRFEPGDEKEVTLVPFAGKRFIFGFNNLVDGWSGDGPTPDYQPNREIAAERAEKLGFKSCKSGGKDAK 159
17986931   81 GLRLDIPANTAVRFEPGDEKEVTLVPFAGKRFIFGFNNLVDGWSGDGPTPDYQPNREIAAERAEKLGFKSCKSGGKDAK 159
225852840  99 GLRLDIPANTAVRFEPGDEKEVTLVPFAGKRFIFGFNNLVDGWSGDGPTPDYQPNREIAAERAEKLGFKSCKSGGKDAK 177
163843615  81 GLRLDIPANTAVRFEPGDEKEVTLVPFAGKRFIFGFNNLVDGWSGDGPTPDYQPNREIAAERAEKLGFKSCKSGGKDAK 159
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap