Conserved Protein Domain Family
ureB

?
PRK13202: ureB 
urease subunit beta; Reviewed
Statistics
?
PSSM-Id: 106171
View PSSM: PRK13202
Aligned: 8 rows
Threshold Bit Score: 200.303
Threshold Setting Gi: 31793039
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
31793039    1 MIPGEIFYGSGDIEMNAAALSRLQMRIINAGDRPVQVGSHVHLPQANRALSFDRATAHGYRLDIPAATAVRFEPGIPQIV 80 
15841317    1 MIPGEIFYGSGDIEMNAAALSRLQMRIINAGDRPVQVGSHVHLPQANRALSFDRATAHGYRLDIPAATAVRFEPGIPQIV 80 
15608986    1 MIPGEIFYGSGDIEMNAAALSRLQMRIINAGDRPVQVGSHVHLPQANRALSFDRATAHGYRLDIPAATAVRFEPGIPQIV 80 
148823060   1 MIPGEIFYGSGDIEMNAAALSRLQMRIINAGDRPVQVGSHVHLPQANRALSFDRATAHGYRLDIPAATAVRFEPGIPQIV 80 
148661655   1 MIPGEIFYGSGDIEMNAAALSRLQMRIINAGDRPVQVGSHVHLPQANRALSFDRATAHGYRLDIPAATAVRFEPGIPQIV 80 
253799107   1 MIPGEIFYGSGDIEMNAAALSRLQMRIINAGDRPVQVGSHVHLPQANRALSFDRATAHGYRLDIPAATAVRFEPGIPQIV 80 
121637752   1 MIPGEIFYGSGDIEMNAAALSRLQMRIINAGDRPVQVGSHVHLPQANRALSFDRATAHGYRLDIPAATAVRFEPGIPQIV 80 
224990236   1 MIPGEIFYGSGDIEMNAAALSRLQMRIINAGDRPVQVGSHVHLPQANRALSFDRATAHGYRLDIPAATAVRFEPGIPQIV 80 
31793039   81 GLVPLGGRREVPGLTLNPPGRLDR 104
15841317   81 GLVPLGGRREVPGLTLNPPGRLDR 104
15608986   81 GLVPLGGRREVPGLTLNPPGRLDR 104
148823060  81 GLVPLGGRREVPGLTLNPPGRLDR 104
148661655  81 GLVPLGGRREVPGLTLNPPGRLDR 104
253799107  81 GLVPLGGRREVPGLTLNPPGRLDR 104
121637752  81 GLVPLGGRREVPGLTLNPPGRLDR 104
224990236  81 GLVPLGGRREVPGLTLNPPGRLDR 104
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap