Conserved Protein Domain Family
ureB

?
PRK13198: ureB 
urease subunit beta; Reviewed
Statistics
?
PSSM-Id: 171897
View PSSM: PRK13198
Aligned: 15 rows
Threshold Bit Score: 261.931
Threshold Setting Gi: 218929740
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22125139   15 MSAKKSTKDSKEQNTPLGGLVLAETPITFNENKPVTKVKVRNTGDRPIQVGSHFHFFEVNRALEFDRAAAYGKRLNISST 94 
218929740   1 MSAKKSTKDSKEQNTPLGGLVLAETPITFNENKPVTKVKVRNTGDRPIQVGSHFHFFEVNRALEFDRAAAYGKRLNISST 80 
108811313  32 MSAKKSTKDSKEQNTPLGGLVLAETPITFNENKPVTKVKVRNTGDRPIQVGSHFHFFEVNRALEFDRAAAYGKRLNISST 111
145598892  32 MSAKKSTKDSKEQNTPLGGLVLAETPITFNENKPVTKVKVRNTGDRPIQVGSHFHFFEVNRALEFDRAAAYGKRLNISST 111
294504460  15 MSAKKSTKDSKEQNTPLGGLVLAETPITFNENKPVTKVKVRNTGDRPIQVGSHFHFFEVNRALEFDRAAAYGKRLNISST 94 
51597258    1 MSAKKSTKDSKEQNTPLGGLVLAETPITFNENKPVTKVKVRNTGDRPIQVGSHFHFFEVNRALEFDRAAAYGKRLNISST 80 
153950720   1 MSAKKSTKDSKEQNTPLGGLVLAETPITFNENKPVTKVKVRNTGDRPIQVGSHFHFFEVNRALEFDRAAAYGKRLNISST 80 
170023378  15 MSAKKSTKDSKEQNTPLGGLVLAETPITFNENKPVTKVKVRNTGDRPIQVGSHFHFFEVNRALEFDRAAAYGKRLNISST 94 
186896361  15 MSAKKSTKDSKEQNTPLGGLVLAETPITFNENKPVTKVKVRNTGDRPIQVGSHFHFFEVNRALEFDRAAAYGKRLNISST 94 
123441299  21 NRGTKSSAGYSEQNTPLGGCILADTPITFNENKPVTKVKVRNTGDRPIQVGSHFHFFEANRALEFDRAAAYGKRLNISST 100
22125139   95 TAIRFEPGDETEVPLIPFGGKQTLYGFNNLVDGWTGEGVVPNSERPDKLAAIRLAAERGFKSSK 158
218929740  81 TAIRFEPGDETEVPLIPFGGKQTLYGFNNLVDGWTGEGVVPNSERPDKLAAIRLAAERGFKSSK 144
108811313 112 TAIRFEPGDETEVPLIPFGGKQTLYGFNNLVDGWTGEGVVPNSERPDKLAAIRLAAERGFKSSK 175
145598892 112 TAIRFEPGDETEVPLIPFGGKQTLYGFNNLVDGWTGEGVVPNSERPDKLAAIRLAAERGFKSSK 175
294504460  95 TAIRFEPGDETEVPLIPFGGKQTLYGFNNLVDGWTGEGVVPNSERPDKLAAIRLAAERGFKSSK 158
51597258   81 TAIRFEPGDETEVPLIPFGGKQTLYGFNNLVDGWTGEGVVPNSERPDKLAAIRLAAERGFKSSK 144
153950720  81 TAIRFEPGDETEVPLIPFGGKQTLYGFNNLVDGWTGEGVVPNSERPDKLAAIRLAAERGFKSSK 144
170023378  95 TAIRFEPGDETEVPLIPFGGKQTLYGFNNLVDGWTGEGVVPNSERPDKLAAIRLAAERGFKSSK 158
186896361  95 TAIRFEPGDETEVPLIPFGGKQTLYGFNNLVDGWTGEGVVPNSERPDKLAAIRLAAERGFKSSK 158
123441299 101 TAIRFEPGDETEVPLIPFGGKQTLYGFNNLVDGWTGEGVVPNSERPDKLEAIRRAAERGFKSSK 164
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap