Conserved Protein Domain Family
PRK13196

?
PRK13196: PRK13196 
pyroglutamyl-peptidase I
Statistics
?
PSSM-Id: 171895
View PSSM: PRK13196
Aligned: 3 rows
Threshold Bit Score: 372.786
Threshold Setting Gi: 94984549
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
94984549    1 MPTLLLTGFERFHTHPSNPSAQAAEALNG-QAVGQAHVVSALLPVEPQAAAAALRALLERHQPDAVLLTGLAAGRPQVTV 79 
15805517    1 MPTLLLTGFEPFHTHPDNPSAQAAQELHGlELPGGWGVHSALLPVEPHAAGAALTRLLSEQDPGAVLLTGLAAGRPQVTL 80 
226356607   1 MSTLLLTGFVPFHTHPVNPSAEAVQALNG-EQAGALRVHSALLPVEPRSAMQTLSRLMDELQPSGVLLTGLAAGRPQVTL 79 
94984549   80 ERVALNVMDFLIPDNAGQTYRDLPActEPNAPAAYLSTLPLRAVVKGWHSAGIPGSISNTAGLYVCNFVLYHALHQLARL 159
15805517   81 ERVGVGVMDFQIPDNAGQTYRDQPI--EPDAPAAYLATLPLRAILAAWREAEIPGDISNSAGLYVCNFVLYHALHWLREH 158
226356607  80 ERVAVNVMDFSIPDNAGGQYQDTPVctGEDAPAAYLSSLPLRRILAAWHDIGIPGHISNTAGLYVCNVVMYHALHQLHLR 159
94984549  160 GRAQVPCGFLHVPANAELALAVSEDQPPLPYLPQEEITRAVRVAVEIVGRRL 211
15805517  159 GRGAVPCGFLHVPANAAVALAVPADRPPLPYLPQSEITRAVRVAAEAITAQS 210
226356607 160 GRAEVPCGFLHVPANPQVALSVAGDRPPLPYLPQEEITRAVRTAAQTMAGQN 211
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap