Conserved Protein Domain Family
PRK13190

?
PRK13190: PRK13190 
putative peroxiredoxin; Provisional
Statistics
?
PSSM-Id: 106159
View PSSM: PRK13190
Aligned: 5 rows
Threshold Bit Score: 377.271
Threshold Setting Gi: 15920801
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15920801    1 MVKLYSKFPDVQVLTTKGPIDFYKDifgKGKWLFLFAHPADFTPVCTTEFVAFSQKYEEFKKLGVELVGLSVDSIYSHIQ 80 
16082572    2 PVTLGQKAPDFTVNTSKGPVTLSSY---RGKWVLLFSHPGDFTPVCTTEFIAFTERYKDFQALGVELLGLSIDSVYSHIA 78 
13541930    2 PVVLGQKAPDFTVNTSKGPITLSNY---RGKWVLLFSHPGDFTPVCTTEFIAFTERYEDFQKLGVELIGLSIDSVFSHIA 78 
146304289   1 MVKTYQKFPDVQVMTTAGPIDFYKDvfgKGKWLFLFAHPADFTPVCTTEFAEFARNYSEFEKLGVQLVGLSVDSIYSHIA 80 
48477799    2 PVYLGKRAPDFTANTTRGVISLSDY---KNKWVLLFSHPADFTPICTTEFIEFSRRYNDFKELNVELIGLSVDSLQSHIE 78 
15920801   81 WLMDIEQRYGVKVPFPVIADPDKKLARMLDALDEASGQTIRIVVLASPDGIIRFVAQYPMEFGRNIDELLRITKAAIVNY 160
16082572   79 WIRDIKEHFGIEIPFPIIADIDKEVARQYNLIDEKSGATVRGVFIIDPNQIVRWMIYYPAETGRNIDEIIRVIKALQFNW 158
13541930   79 WIRDIKEHFGIDIPFPIIADIDKEVAREYNLIDEKSGATVRGVFIIDPNQIVRWMIYYPAETGRNIEEIIRVIKALQFNW 158
146304289  81 WLTDIEQRYGLKIPFPVIADPEKKLARLLDLVEENSGLTVRGVFIVDPQGTIRFMAQYPIEAGRNIQELIRITKALIVSY 160
48477799   79 WLKDIYEKFGIEIQFPVIADINKEIAREYNLIDENAGNTVRGVFIIDPNQTVRWMIYYPAETGRNIDEILRSVKALQANW 158
15920801  161 KAKVVLPANWQPGQDVIVPPPAIFDEAEMRIKLPNAKAWYLLFKK 205
16082572  159 ERKLATPANWQPGQEGIEGAPSTVDASLKRDGEPGVKTWYLKFVK 203
13541930  159 DRKLATPANWQPGQEGIEPAPTTVDSSFKRDNEQGVKTWYLKFVK 203
146304289 161 KAKVSTPVNWEPGKEVVVGAPTTLMEAEMRMKLPNAKAWYLMFKK 205
48477799  159 SRKIATPVNWRPGDKGILPPPSTLEDALQRIRE-GNKTWYIKTE- 201
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap