Conserved Protein Domain Family
psbN

?
PRK13183: psbN 
photosystem II reaction center protein PsbN
Statistics
?
PSSM-Id: 171884
View PSSM: PRK13183
Aligned: 27 rows
Threshold Bit Score: 55.818
Threshold Setting Gi: 220908885
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148238648  1 MESSSPALSVAIAVLAALLGLTGFGVYTAFGPPSKRLDDPFDDHED 46 
81299035   1 MMEASPGLSIAITFAVILLALTGFSIYTSFGPPSKQLEDPFEDHED 46 
16330222   1 ---MESATVLSITFAVILIAITGLAVYTSFGPPSAELGDPFDDHED 43 
75910648   1 ---MEPAIVLIISVGAALVAVTGYGIYTAFGPPSRELSDPFEDHED 43 
17228342   1 ---MEPAIVLIISVGAALVAVTGYGIYTAFGPPSRELSDPFEDHED 43 
186684436  1 ---MEPAIVLSISMAAVVVAITGISIYTSFGPPSKELNDPFDDHED 43 
161485631  1 ---MEPATVLSISIGVMVVAITGFSIYTAFGPPSKELVDPFDEHED 43 
124024152  2 ENSSSETYSLLIAMVTITFGLTGYGLYTAFGPPSKELEDPFEEHED 47 
33864105   3 ENSSSETYSLLIAMVTITFGLTGYGLYTAFGPPSKELEDPFEEHED 48 
220908885  1 ---MEPATVLSIAIAGICIAITGLAIYTSFGPPSRELADPFDEHED 43 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap