Conserved Protein Domain Family
hisH

?
PRK13152: hisH 
imidazole glycerol phosphate synthase subunit HisH; Provisional
Statistics
?
PSSM-Id: 171876
View PSSM: PRK13152
Aligned: 7 rows
Threshold Bit Score: 341.434
Threshold Setting Gi: 153952021
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
218778489   1 MIGIVDHGMGNLLSVFNAFEYMGADVELCGDPRDLEDADKIVLPGVGAFPDCMKNLKELGFQEVLNRLVLEEKRPVLGIC 80 
57238367    1 MIALIDYKAGNLNSVAKAFEKIGAINFIAKNPKDLQKADKLLLPGVGSFKEAMKNLKELGFIEALKEQVLVQKKPILGIC 80 
222824320   1 MICIIDYDLGNLRSIQKAFEAINQKVIISKKEQDIKNASKLLLPGVGSFKKGMENLKNLHLDELLKEEIIIKKKPILGIC 80 
153952021   5 MIALIDYKAGNLNSVAKAFEKIGATNFIAQNPKDLQKADKLLLPGVGSFKEAMKNLKELGFIEALKEQVLVQKKPILGIC 84 
218562926   1 MIALIDYKAGNLNSVAKAFEKIGAINFIAKNPKDLQKADKLLLPGVGSFKEAMKNLKELGFIEALKEQVLVQKKPILGIC 80 
121612873   1 MIALIDYKAGNLNSVAKAFEKIGAINFIAKNPKDLQKADKLLLPGVGSFKEAMKNLKELGFIEALKEQVLVQKKPILGIC 80 
157415569   1 MIALIDYKTGNLNSVAKAFEKIGATNFIAKNPKDLQKADKLLLPGVGSFKEAMKNLKELGFIEALKEQVLVQKKPILGIC 80 
218778489  81 LGMQVMAEWGEEFGEHQGLGWIPGRVVRIRpEDPGLKVPHVGWNNIRYSSDSPLLKGLPESPDFYFVHSFHMECTDpAHV 160
57238367   81 LGMQLFLERGYEGGVCEGLGFIEGEVVKFE-EDLNLKIPHMGWNELEILKQVPLYQGIDNKSDFYFVHSFYVKCKD-EFV 158
222824320  81 LGMQLFCKLGFEGGECEGLGFVDAQVLQFD-LKNEKKL-HSGWDNIYYKNASEIFKNIKENSDFYFVHSYYVKCNE-NAQ 157
153952021  85 LGMQLFLEKGYEGGVCEGLGFVEGEVVKFE-EDLNLKIPHMGWNELEILKQEPLYQGMEDKSDFYFVHSFYVRCKD-EFV 162
218562926  81 LGMQLFLERGYEGGVCEGLGFIEGEVVKFE-EDLNLKIPHMGWNELEILKQVPLYQGIDNKSDFYFVHSFYVKCKD-EFV 158
121612873  81 LGMQLFLERGYEGGVCEGLGFIEGEVVKFE-EDLNLKIPHMGWNELEILKQDPLYQGINNKSDFYFVHSFYVKCKD-EFV 158
157415569  81 LGMQLFLERGYEGGVCEGLGFIEGEVVKFE-EDLNLKIPHMGWNELEILKQEPLYQDIEDKSDFYFVHSFYVRCKD-EFV 158
218778489 161 DAWCDYGGRVTAAVRRDNIFATQFHPEKSQDFGLKIIENFLSW 203
57238367  159 SAKAQYGHKFVASLQKDHIFATQFHPEKSQNLGLKLLENFIRL 201
222824320 158 TSMCDYEISFCSSFEKENIYAVQFHPEKSQSVGLKLLENFAKL 200
153952021 163 SAKAQYGHKFVASLQKDHIFATQFHPEKSQNLGLKLLENFVRL 205
218562926 159 SAKAQYGHKFVASLQKDHIFATQFHPEKSQNLGLKLLENFARL 201
121612873 159 SAKAQYGHKFVASLQKDRIFATQFHPEKSQNLGLKLLENFARL 201
157415569 159 SAKAQYGHKFVASLQKDHIFATQFHPEKSQNLGLKLLENFVRL 201
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap