Conserved Protein Domain Family
PRK13150

?
PRK13150: PRK13150 
cytochrome c maturation protein CcmE
Statistics
?
PSSM-Id: 139376
View PSSM: PRK13150
Aligned: 17 rows
Threshold Bit Score: 286.5
Threshold Setting Gi: 260598763
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
198244242   1 MNLRRKNRLWVVCAVLAGLGLTTALVLYALRANIDLFYTPGEILYGKRETQQLPAVGQRLRVGGMVMPGSVRRDPDSLKV 80 
161505653   1 MNLRRKNRLWVVCAVLAGLALTTALVLYALRANIDLFYTPGEILYGRRETQQMPEVGQRLRVGGMVMPGSVKRAPDSLKV 80 
56415695    1 MNLRRKNRLWVVCAVLAGLALTTALVLYALRANIDLFYTPGEILYGKRETQQLPAVGQRLRVGGMVMPGSVRRDPDSLKV 80 
197364622   1 MNLRRKNRLWVVCAVLAGLALTTALVLYALRANIDLFYTPGEILYGKRETQQLPAVGQRLRVGGMVMPGSVRRDPDSLKV 80 
161616930   1 MNLRRKNRLWVVCAVLAGLALTTALVLYALRANIDLFYTPGEILYGKRETQQLPAVGQRLRVGGMVMPGSVRRDPDSLKV 80 
224585615   1 MNLRRKNRLWVVCAVLAGLALTTALVLYALRANIDLFYTPGEILYGKRETQQLPAVGQRLRVGGMVMPGSVRRDPDSLKV 80 
29143996    1 MNLRRKNRLWVVCAVLAGLALTTALVLYALRANIDLFYTPGEILYGKRETQQLPAVGQRLRVGGMVMPGSVRRDPDSLKV 80 
16762507    1 MNLRRKNRLWVVCAVLAGLALTTALVLYALRANIDLFYTPGEILYGKRETQQLPAVGQRLRVGGMVMPGSVRRDPDSLKV 80 
207859040   1 MNLRRKNRLWVVCAVLAGLALTTALVLYALRANIDLFYTPGEILYGKRETQQLPAVGQRLRVGGMVMPGSVRRDPDSLKV 80 
205354597   1 MNLRRKNRLWVVCAVLAGLALTTALVLYALRANIDLFYTPGEILYGKRETQQLPAVGQRLRVGGMVMPGSVRRDPDSLKV 80 
198244242  81 NFSLYDAEGAVTVSYEGILPDLFREGQGVVVQGTLEKGNHVLAHEVLAKHDENYTPpevekamPEVEKAMQENHRRPQRA 160
161505653  81 NFSLYDAEGVVEVTYDGILPDLFREGQGVVVQGELDRRNHVQAKEVLAKHDENYTP-------PEVEKAMQENHRRPQSG 153
56415695   81 NFSLYDAEGSVTVSYEGILPDLFREGQGVVVQGTLEKGNHVLAHEVLAKHDENYTP-------PEVEKAMQENHRRPQRA 153
197364622  81 NFSLYDAEGSVTVSYEGILPDLFREGQGVVVQGTLEKGNHVLAHEVLAKHDENYTP-------PEVEKAMQENHRRPQRA 153
161616930  81 NFSLYDAEGSVTVSYEGILPDLFREGQGVVVQGTLEKGNHVLAHEVLAKHDENYTP-------PEVEKAMQENHRRPQRA 153
224585615  81 NFSLYDAEGSVTVSYEGILPDLFREGQGVVVQGTLEKGNHVLAHEVLAKHDENYTP-------PEVEKAMQENHRRPQRV 153
29143996   81 NFSLYDAEGSVTVSYEGILPDLFREGQGVVVQGTLEKGNHVLAHEVLAKHDENYTP-------PEVEKAMQENHRRPQRA 153
16762507   81 NFSLYDAEGSVTVSYEGILPDLFREGQGVVVQGTLEKGNHVLAHEVLAKHDENYTP-------PEVEKAMQENHRRPQRA 153
207859040  81 NFSLYDAEGSVTVSYEGILPDLFREGQGVVVQGTLEKGSHVLAQEVLAKHDENYTP-------PEVEKAMQENHRRPQRA 153
205354597  81 NFSLYDAEGAVTVSYEGILPDLFREGQGVVVQGTLEKGSHVLAQEVLAKHDENYTP-------PEVEKAMQENHRRPQRA 153
198244242 161 DKDTSS 166
161505653 154 YKDKSS 159
56415695  154 DKDTSS 159
197364622 154 DKDTSS 159
161616930 154 DKDTSS 159
224585615 154 DKDTSS 159
29143996  154 DKDTSS 159
16762507  154 DKDTSS 159
207859040 154 DKDTSS 159
205354597 154 DKDTSS 159
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap