Conserved Protein Domain Family
hisH

?
PRK13142: hisH 
imidazole glycerol phosphate synthase subunit HisH; Provisional
Statistics
?
PSSM-Id: 171871
View PSSM: PRK13142
Aligned: 19 rows
Threshold Bit Score: 361.063
Threshold Setting Gi: 224476123
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
224476123   1 MIAIVDYGVGNIKNVERAIHHLSYETALTNDPEVIRSSSHIVLPGVGHFKDAMQALKNSGLDKLLIElQNDKPFIGICLG 80 
82752254    1 MIVIVDYGLGNISNVKRAIEHLGYEVVVSNKQNIIDQAETIILPGVGHFKDAMSEIKRLNLDAILAK-NTDKKMIGICLG 79 
57865754    1 MIAIIDYGLGNISNVTRAIQHLGYDVILTCDDKDVQKAEAIVLPGVGHFQDAMHSIEEKSIKDMLKN-IHDKPIIGICLG 79 
27467192    1 MIAIIDYGLGNISNVTRAIQHLGYDVILTCNDKDVQKAEAIVLPGVGHFQDAMHSIEEKSIKDMLKN-IHDKPVIGICLG 79 
49484870    1 MIVIVDYGLGNISNVKRAIEHLGYEVVVSNKQNIIDQAETIILPGVGHFKDAMSEIKRLNLDAILAK-NTDKKMIGICLG 79 
150395190   1 MIVIVDYGLGNISNVKRAIEHLGYEVVVSNTSKIIDQAETIILPGVGHFKDAMSEIKRLNLNAILAK-NTDKKMIGICLG 79 
156980990   1 MIVIVDYGLGNISNVKRAIEHLGYEVVVSNTSKIIDQAETIILPGVGHFKDAMSEIKRLNLNAILAK-NTDKKMIGICLG 79 
151222785   1 MIVIVDYGLGNISNVKRAIEHLGYEVVVSNTSKIIDQAETIILPGVGHFKDAMSEIKRLNLNAILAK-NTDKKMIGICLG 79 
269204315   1 MIVIVDYGLGNISNVKRAIEHLGYEVVVSNTSKIIDQAETIILPGVGHFKDAMSEIKRLNLNAILAK-NTDKKMIGICLG 79 
87162363    1 MIVIVDYGLGNISNVKRAIEHLGYEVVVSNTSKIIDQAETIILPGVGHFKDAMSEIKRLNLNAILAK-NTDKKMIGICLG 79 
224476123  81 MQLMFNHSAEGDTDGLGMINGEVVPIKTDYPVPHLGWNNLESKHPLLNQDVYFIHSFYVQTDAPIIAAADYGIPITTIVQ 160
82752254   80 MQLMYEHSDEGDASGLGFIPGNISRIQTEYPVPHLGWNNLVSKHPMLNQDVYFVHSYQAPMSENVIAYAQYGTDIPAIVQ 159
57865754   80 MQLLFQHSAEGDVSGLELVPGNIVPIQSSHPIPHLGWNELKSTHPLLQSDVYFVHSYQAEMSEYVVAYADYGTKIPGVIQ 159
27467192   80 MQLLFQHSAEGDVSGLELVPGNIVPIQSSHPIPHLGWNELKSTHPLLQSDVYFVHSYQAEMSEYVVAYADYGTKIPGVIQ 159
49484870   80 MQLMYEHSDEGDASGLGFIPGNISRIQTEYPVPHLGWNNLVSKHPMLNQDVYFVHSYQAPMSENVIAYAQYGTDIPAIVQ 159
150395190  80 MQLMYEHSDEGDASGLGFIPGNISRIQTEYPVPHLGWNNLVSKHPMLNQDVYFVHSYQAPMSENVIAYAQYGADIPAIVQ 159
156980990  80 MQLMYEHSDEGDASGLGFIPGNISRIQTEYPVPHLGWNNLVSKHPMLNQDVYFVHSYQAPMSENVIAYAQYGADIPAIVQ 159
151222785  80 MQLMYEHSDEGDASGLGFIPGNISRIQTEYPVPHLGWNNLVSKHPMLNQDVYFVHSYQAPMSENVIAYAQYGADIPAIVQ 159
269204315  80 MQLMYEHSDEGDASGLGFIPGNISRIQTEYPVPHLGWNNLVSKHPMLNQDVYFVHSYQAPMSENVIAYAQYGADIPAIVQ 159
87162363   80 MQLMYEHSDEGDASGLGFIPGNISRIQTEYPVPHLGWNNLVSKHPMLNQDVYFVHSYQAPMSENVIAYAQYGADIPAIVQ 159
224476123 161 SGNKIGIQFHPEKSGDYGLEILNQALKGGFIHD 193
82752254  160 FNNYIGIQFHPEKSGTYGLQILRQAIQGGFIND 192
57865754  160 YRNYIGIQFHPEKSGTYGLEILNQALKGGFIND 192
27467192  160 YRNYIGIQFHPEKSGTYGLEILNQALKGGFIND 192
49484870  160 FNNYIGIQFHPEKSGTYGLQILRQAIQGGFIND 192
150395190 160 FNNYIGIQFHPEKSGTYGLQILRQAIQGGFIND 192
156980990 160 FNNYIGIQFHPEKSGTYGLQILRQAIQGGFIND 192
151222785 160 FNNYIGIQFHPEKSGTYGLQILRQAIQGGFIND 192
269204315 160 FNNYIGIQFHPEKSGTYGLQILRQAIQGGFIND 192
87162363  160 FNNYIGIQFHPEKSGTYGLQILRQAIQGGFIND 192
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap