Conserved Protein Domain Family
PRK13128

?
PRK13128: PRK13128 
D-aminopeptidase; Reviewed
Statistics
?
PSSM-Id: 171868
View PSSM: PRK13128
Aligned: 15 rows
Threshold Bit Score: 865.707
Threshold Setting Gi: 126464718
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
58039691    1 MSDSFSARLEAAVSALPARFPGPGGAVAVLKDGEVLVRHGWGYANVERRIPFTPSTLFRMCSITKQFTCGTLLDLYDDPS 80 
83269209    1 MPNIDLPTLEAFVHAIPQNYKGPGGAVAVVRNGEIVLRHAWGFADLAARKAMTPETRMPICSVSKQFTCAVLLDCIGEPE 80 
189022490   1 MPNIDLPTLEAFVHAIPQNYKGPGGAVAVVRNGEIVLRHAWGFADLAARKAMTPETRMPICSVSKQFTCAVLLDCIGEPE 80 
23500673    1 MPNIDLPTLEAFVHAIPQNYKGPGGAVAVVRNGEIVLRHAWGFADLAARKAMTPETRMPICSVSKQFTCAVLLDCIGEPE 80 
62317228    1 MPNIDLPTLEAFVHAIPQNYKGPGGAVAVVRNGEIVLRHAWGFADLAARKAMTPETRMPICSVSKQFTCAVLLDCIGEPE 80 
161620999   1 MPNIDLPTLEAFVHAIPQNYKGPGGAVAVVRNGEIVLRHAWGFADLAARKAMTPETRMPICSVSKQFTCAVLLDCIGEPE 80 
256015708   1 MPNIDLPTLEAFVHAIPQNYKGPGGAVAVVRNGEIVLRHAWGFADLAARKAMTPETRMPICSVSKQFTCAVLLDCIGEPE 80 
163845061   1 MPNIDLPTLEAFVHAIPQNYKGPGGAVAVVRNGEIVLRHAWGFADLAARKAMTPETRMPICSVSKQFTCAVLLDCIGEPE 80 
153008743   1 MSKFDLSALETFVRTIPQHYKGPGGAVAVLKDGKVVLRHAWGFADLSTRKAMTPETRMPICSVSKQFTCAVLLDSVGEPE 80 
77465254    1 -MTLDLDALDRALDALPNLFRGPGGVAGVVKDGQVVASRAWGYADLTRRRPMETGTRLPICSISKQFTCGALLDTLGDTA 79 
58039691   81 ELDADVDARLPQLDEPSPGMLHLAHNQSGLRDYWAVAMLHGAPIEGYFGDREARRVIDGTRTLQFQPGTSYSYVNQNFRL 160
83269209   81 MLDSALAAYLDQFEDGRPAVRDLCNNQSGLRDYWALTVLCGAAPEGIFLPDQAQNLLRRLKTTHFAPGTHYSYCNGNFRI 160
189022490  81 MLDSALAAYLDQFEDGRPAVRDLCNNQSGLRDYWALTVLCGAAPEGIFLPDQAQNLLRRLKTTHFAPGTHYSYCNGNFRI 160
23500673   81 MLDSALAAYLDQFEDGRPAVRDLCNNQSGLRDYWALTVLCGAAPEGIFLPDQAQNLLRRLKTTHFAPGTHYSYCNGNFRI 160
62317228   81 MLDSALAAYLDQFEDGRPAVRDLCNNQSGLRDYWALTVLCGAAPEGIFLPDQAQNLLRRLKTTHFAPGTHYSYCNGNFRI 160
161620999  81 MLDSALAAYLDQFEDGRPAVRDLCNNQSGLRDYWALTVLCGAAPEGIFLPDQAQNLLRRLKTTHFAPGTHYSYCNGNFRI 160
256015708  81 MLDSALAAYLDQFEDGRPAVRDLCNNQSGLRDYWALTVLCGAAPEGIFLPDQAQNLLRRLKTTHFAPGTHYSYCNGNFRI 160
163845061  81 MLDSALAAYLDQFEDGRPAVRDLCNNQSGLRDYWALTVLCGAAPEGIFLPDQAQNLLRRLKTTHFAPGTHYSYCNGNFRI 160
153008743  81 VLDDALAAYLDKFAEKRPSVRDLCNNQSGLRDYWALTVLCGADPEGVFLPEQAQSLLRRLKTTHFAPGTHYSYCNGNFRI 160
77465254   80 AYDARVAEFLPQFEGPLPTLRQLCDNQSGLRDYWALTVLQGAEAAQTFRREDALPLIARMKTGHFPPGTAYSYCNCNFRI 159
58039691  161 ISDILQDRTGRSFAELLQTSIFNPVGMERAILAAETrAMPDGTVGYEGSVESGFRPAINNIWWTGDAGLGASLDDMIAWE 240
83269209  161 LADLIEQHTGRSLADLLAERIFAPAAMKTAELIPDT-ALFNECTGYEGDTVRGFLPAINRIHWLGDAGICASLDDMIAWE 239
189022490 161 LADLIEQHTGRSLADLLAERIFAPAAMKTAELIPDT-ALFNECTGYEGDTVRGFLPAINRIHWLGDAGICASLDDMIAWE 239
23500673  161 LADLIEQHTGRSLADLLAERIFAPAAMKTAELIPDT-ALFNECTGYEGDTVRGFLPAINRIHWLGDAGICASLDDMIAWE 239
62317228  161 LADLIEQHTGRSLADLLAERIFAPAAMKTAELIPDT-ALFNECTGYEGDTVRGFLPAINRIHWLGDAGICASLDDMIAWE 239
161620999 161 LADLIEQHTGRSLADLLAERIFAPAAMKTAELIPDT-ALFNECTGYEGDTVRGFLPAINRIHWLGDAGICASLDDMIAWE 239
256015708 161 LADLIEQHTGRSLADLLAERIFAPAAMKTAELIPDT-ALFNECTGYEGDTVRGFLPAINRIHWLGDAGICASLDDMIAWE 239
163845061 161 LADLIEQHTGRSLADLLAERIFAPAAMKTAELIPDT-ALFNECTGYEGDTVRGFLPAINRIHWLGDAGICASLDDMIAWE 239
153008743 161 LADLIEQHTGRSLIELLSERIFQPAGMKTAELIPDT-ALFDECTGYEGDTVRGFLPAVNRIHWMGDAGICASLDDMIAWE 239
77465254  160 VSEILESETGRALRDLYAERIFGPAGMRTAELTSDTrHPADEVVGYEGSDAVGFFPADNGIFWIGDAGISASLQDMLAYE 239
58039691  241 RFIDETRDAPDSLYRRLTVPVTFSDGQPAPYGFGLQRTKMFGRDVTMHGGALRGWRSHRLHVASERLSVVVMFNHMSAAQ 320
83269209  240 QFIDRTRHDENGLYRRLSSPQTFADGAPAPYGFGLKFEETGGKRLTGHGGALRGWRCQRWHCADERISTIVMFNFEGNAS 319
189022490 240 QFIDRTRHDENGLYRRLSSPQTFADGAPAPYGFGLKFEETGGKRLTGHGGALRGWRCQRWHCADERISTIVMFNFEGNAS 319
23500673  240 QFIDRTRHDENGLYRRLSSPQTFADGAPAPYGFGLKFEETGGKRLTGHGGALRGWRCQRWHCADERISTIVMFNFEGNAS 319
62317228  240 QFIDRTRHDENGLYRRLSSPQTFADGAPAPYGFGLKFEETGGKRLTGHGGALRGWRCQRWHCADERISTIVMFNFEGNAS 319
161620999 240 QFIDRTRHDENGLYRRLSSPQTFADGAPAPYGFGLKFEETGGKRLTGHGGALRGWRCQRWHCADERISTIVMFNFEGNAS 319
256015708 240 QFIDRTRHDENGLYRRLSSPQTFADGAPAPYGFGLKFEETGGKRLTGHGGALRGWRCQRWHCADERISTIVMFNFEGNAS 319
163845061 240 QFIDRTRHDENGLYRRLSSPQTFADGAPAPYGFGLKFEETGGKRLTGHGGALRGWRCQRWHCADERISTIVMFNFEGNAS 319
153008743 240 QFIDATRDDESGIYRRLSGLQTFSDGAAAPYGLGLKFEETGGKRLTGHGGALRGWRCQRWHCADERLSTIAMFNFEGGAS 319
77465254  240 SWIDATRNDENSIYRRISVPPAYVCGTPASYGFGLSHETVAGVKVTGHGGALRGFRAQRFHAADERLSVVVIFNHEASAH 319
58039691  321 VASAQILAAALGVPYEPERSTQQPTALYGTYLERETGLSARIEPAPGG-AKLRYLMVPELLEGISATRAEAGSVVVKaqe 399
83269209  320 DAALKMMNAALGIPPAKPVRAQANPGWFGSWLNPETGLVLSLEDAGGGrMKARFGTGPEIMDISGENEAQSSMTTLR--- 396
189022490 320 DAALKMMNAALGIPPAKPVRAQANPGWFGSWLNPETGLVLSLEDAGGGrMKARFGTGPEIMDISGENEAQSSMTTLR--- 396
23500673  320 DAALKMMNAALGIPPAKPVRAQANPGWFGSWLNPETGLVLSLEDAGGGrMKARFGTGPEIMDISGENEAQSSMTTLR--- 396
62317228  320 DAALKMMNAALGIPPAKPVRAQANPGWFGSWLNPETGLVLSLEDAGGGrMKARFGTGPEIMDISGENEAQSSMTTLR--- 396
161620999 320 DAALKMMNAALGIPPAKPVRAQANPGWFGSWLNPETGLVLSLEDAGGGrMKARFGTGPEIMDISGENEAQSSMTTLR--- 396
256015708 320 DAALKMMNAALGIPPAKPVRAQANPGWFGSWLNPETGLVLSLEDAGGGrMKARFGTGPEIMDISGENEAQSSMTTLR--- 396
163845061 320 DAALKMMNAALGIPPAKPVRAQANPGWFGSWLNPETGLVLSLEDAGGGrMKARFGTGPEIMDISGENEAQSSMTTLR--- 396
153008743 320 DVAFKLMNIALGVPTSEQVRVAADAVWFGSWLDHETGLVLSLEDAGRGrMKARFGTGPEMMDVVGENEARSSMTAIR--- 396
77465254  320 AAASSLLAAALGHEAPKGARPE---GWAGQWLDPESGLLLRVGEDAEG-LTLRFATGPDRLTAGEDGVPRGAGVSLA--- 392
58039691  400 tAEGAEAVMERPGENRTSILARCDETPGEDiaeLAGVYRCEELdEAEVTIELAGGVVYGGFSGILGDGRMEMLQRLAKDV 479
83269209  397 -RDGDMIHLARKDENLHLAMHRLKGEARQD---IAGRYRSDEL-EADLLLVSEGGAIYGAFEGFLGKSDMYPLYAAGPDV 471
189022490 397 -RDGDMIHLARKDENLHLAMHRLKGEARQD---IAGRYRSDEL-EADLLLVSEGGAIYGAFEGFLGKSDMYPLYAAGPDV 471
23500673  397 -RDGDMIHLARKDENLHLAMHRLKGEARQD---IAGRYRSDEL-EADLLLVSEGGAIYGAFEGFLGKSDMYPLYAAGPDV 471
62317228  397 -RDGDMIHLARKDENLHLAMHRLKGEARQD---IAGRYRSDEL-EADLLLVSEGGAIYGAFEGFLGKSDMYPLYAAGPDV 471
161620999 397 -RDGDMIHLARKDENLHLAMHRLKGEARQD---IAGRYRSDEL-EADLLLVSEGGAIYGAFEGFLGKSDMYPLYAAGPDV 471
256015708 397 -RDGDMIHLARKDENLHLAMHRLKGEARQD---IAGRYRSDEL-EADLLLVSEGGAIYGAFEGFLGKSDMYPLYAAGPDV 471
163845061 397 -RDGDMIHLARKDENLHLAMHRLKGEARQD---IAGRYRSDEL-EADLLLVSEGGAIYGAFEGFLGKSDMYPLYAAGPDV 471
153008743 397 -RDGDTIHLAREDENLSLTMQRLKGAAKQD---IAGHYRSDEL-EADLLIVDEGGAFYGAFEGFLGKSDMYSLYEAGPDV 471
77465254  393 -REGAMLVMNRTSDNLTVRAEPLPVVAVADageIAGRYHAREL-EADLVIEARDGGAYAGFEGLLGAGPMERLHPVGPDV 470
58039691  480 WVLPCPRALDHTAPGDWTLAFERQG-GSVTAVRVGCWLARDLMYQRV 525
83269209  472 WLLPVQRSMDAPSPGEWKLVFHRDAaGRITGVTVGCWLARGVEYKRL 518
189022490 472 WLLPVQRSMDAPSPGEWKLVFHRDAaGRITGVTVGCWLARGVEYKRL 518
23500673  472 WLLPVQRSMDAPSPGEWKLVFHRDAaGRITGVTVGCWLARGVEYKRL 518
62317228  472 WLLPVQRSMDAPSPGEWKLVFHRDAaGRITGVTVGCWLARGVEYKRL 518
161620999 472 WLLPVQRSMDAPSPGEWKLVFHRDAaGRITGVTVGCWLARGVEYKRL 518
256015708 472 WLLPVQRSMDAPSPGEWKLVFHRDAaGRITGVTVGCWLARGVEYKRL 518
163845061 472 WLLPVQRSMDAPSPGEWKLVFHRDAaGRITGVTVGCWLARGVEYKRL 518
153008743 472 WLLPVQRSMDAPSPGEWKLVFHRDAkGEITGMTVGCWLARHVDYRRI 518
77465254  471 WIVTTRRSMDAPAPGDWTLQVRREG-GAVTGLRLGCWLARRIDYARV 516
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap