Conserved Protein Domain Family
PRK13043

?
PRK13043: PRK13043 
superantigen-like protein SSL14; Reviewed
Statistics
?
PSSM-Id: 171855
View PSSM: PRK13043
Aligned: 15 rows
Threshold Bit Score: 444.537
Threshold Setting Gi: 82750775
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148267659   1 MKKNIMNKLVLSTALLLLGTTSTQLPKTPISFSSEAKAYNISENETNINELIKYYTQPHFSLSGKWLWQKPNGSIHATLQ 80 
49486006    1 MKKNIMNKLVLSTALLLLGTTSTQLPKTPISFSSEAKAYNISENETNINELIKYYTQPHLSLSNKWLWQKPNGSIHATLQ 80 
87160115    1 MKKNIMNKLVLSTALLLLETTSTQLPKTPISFSSEAKAYNISENETNINELIKYYTQPHFSLSGKWLWQKPNGSIHATLQ 80 
151221289   1 MKKNIMNKLVLSTALLLLETTSTQLPKTPISFSSEAKAYNISENETNINELIKYYTQPHFSLSGKWLWQKPNGSIHATLQ 80 
21282778    1 MKKNIMNKLVLSTALLLLGTTSTQLPKTPISFSSEAKAYNISENETNINELIKYYTQPHLSLSNKWLWQKPNGSIHATLQ 80 
57650279    1 MKKNIMNKLVLSTALLLLETTSTQLPKTPISFSSEAKAYNISENETNINELIKYYTQPHFSLSGKWLWQKPNGSIHATLQ 80 
82750775    1 MKKNIMNKLVLSTALLLLGTTSTQLPKTPISFSSEAKAYNISENETNINELIKYYTQPHFSLSNKWLWQKPNGSIHATLQ 80 
88194870    1 MKKNIMNKLVLSTALLLLETTSTQLPKTPISFSSEAKAYNISENETNINELIKYYTQPHFSLSGKWLWQKPNGSIHATLQ 80 
156979489   1 MKKNIMNKLVLSTALLLLGTTSTQLPKTPISFSSEAKAYNISENETNINELIKYYTQPHFSLSGKWLWQKPNGSIHATLQ 80 
161509342   1 MKKNIMNKLVLSTALLLLETTSTQLPKTPISFSSEAKAYNISENETNINELIKYYTQPHFSLSGKWLWQKPNGSIHATLQ 80 
148267659  81 TWVWYSHIQVFGSESWGNINQLRNKYVDIFGTKDEDTVEGYWTYDETFTGGVTPAATSSDKPYRLFLKYSDKQQTIIGGH 160
49486006   81 TWVWYSHIQVFGSESWGNINQLRNKYVDIFGTKDEDTVEGYWTYDETFTGGVTPAATSSDKPYRLFLKYSDKQQTIIGGH 160
87160115   81 TWVWYSHIQVFGSESWGNINQLRNKYVDIFGTKDEDTVEGYWTYDETFTGGVTPAATSSDKPYRLFLKYSDKQQTIIGGH 160
151221289  81 TWVWYSHIQVFGSESWGNINQLRNKYVDIFGTKDEDTVEGYWTYDETFTGGVTPAATSSDKPYRLFLKYSDKQQTIIGGH 160
21282778   81 TWVWYSHIQVFGSESWGNINQLRNKYVDIFGTKDEDTVEGYWTYDETFTGGVTPAATSSDKPYRLFLKYSDKQQTIIGGH 160
57650279   81 TWVWYSHIQVFGSESWGNINQLRNKYVDIFGTKDEDTVEGYWTYDETFTGGVTPAATSSDKPYRLFLKYSDKQQTIIGGH 160
82750775   81 TWVWYSHIQVFGSESWGNINQLRNKYVDIFGTKDEDTVEGYWTYDETFTGGVTPAATSFDKPYRLFLKYSDKQQTIIGGH 160
88194870   81 TWVWYSHIQVFGSESWGNINQLRNKYVDIFGTKDEDTVEGYWTYDETFTGGVTPAATSSDKPYRLFLKYSDKQQTIIGGH 160
156979489  81 TWVWYSHIQVFGSESWGNINQLRNKYVDIFGTKDEDTVEGYWTYDETFTGGVTPAATSSDKPYRLFLKYSDKQQTIIGGH 160
161509342  81 TWVWYSHIQVFGSESWGNINQLRNKYVDIFGTKDEDTVEGYWTYDETFTGGVTPAATSSDKPYRLFLKYSDKQQTIIGGH 160
148267659 161 EFYKGNKPVLTLKELDFRIRQTLIKNKKLYNGEFNKGQIKITADGNNYTIDLSKKLKLTDTNRYVKNPKNAQIEVILEKS 240
49486006  161 EFYKGNKPVLTLKELDFRIRQTLIKNKKLYNGEFNKGQIKITADGNNYTIDLSKKLKLTDTNRYVKNPKNAQIEVILEKS 240
87160115  161 EFYKGNKPVLTLKELDFRIRQTLIKNKKLYNGEFNKGQIKITADGNNYTIDLSKKLKLTDTNRYVKNPRNAEIEVILEKS 240
151221289 161 EFYKGNKPVLTLKELDFRIRQTLIKNKKLYNGEFNKGQIKITADGNNYTIDLSKKLKLTDTNRYVKNPRNAEIEVILEKS 240
21282778  161 EFYKGNKPVLTLKELDFRIRQTLIKNKKLYNGEFNKGQIKITADGNNYTIDLSKKLKLTDTNRYVKNPKNAQIEVILEKS 240
57650279  161 EFYKGNKPVLTLKELDFRIRQTLIKNKKLYNGEFNKGQIKITADGNNYTIDLSKKLKLTDTNRYVKNPRNAEIEVILEKS 240
82750775  161 EFYKGNKPVLTLKELDFRIRQTLIKNKKLYNGEFNKGQIKITADGNNYTIDLSKKLKLTDTNRYVKNPKNAQIEVILEKS 240
88194870  161 EFYKGNKPVLTLKELDFRIRQTLIKNKKLYNGEFNKGQIKITADGNNYTIDLSKKLKLTDTNRYVKNPRNAEIEVILEKS 240
156979489 161 EFYKGNKPVLTLKELDFRIRQTLIKNKKLYNGEFNKGQIKITADGNNYTIDLSKKLKLTDTNRYVKNPKNAQIEVILEKS 240
161509342 161 EFYKGNKPVLTLKELDFRIRQTLIKNKKLYNGEFNKGQIKITADGNNYTIDLSKKLKLTDTNRYVKNPRNAEIEVILEKS 240
148267659 241 N 241
49486006  241 N 241
87160115  241 N 241
151221289 241 N 241
21282778  241 N 241
57650279  241 N 241
82750775  241 N 241
88194870  241 N 241
156979489 241 N 241
161509342 241 N 241
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap