Conserved Protein Domain Family
PRK13041

?
PRK13041: PRK13041 
superantigen-like protein SSL2; Reviewed
Statistics
?
PSSM-Id: 106078
View PSSM: PRK13041
Aligned: 15 rows
Threshold Bit Score: 443.307
Threshold Setting Gi: 87161928
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
49482651    1 MKMKSIAKVSLVLGILATGVNTVTEQPVHAENKHVQVSQNSKNLKAYYTQPSVEYKNVTGYISSIQpkPGTKFLNMIEGN 80 
49485289    1 MKMKSIVKISLLLGILATGVNTTTEKPVHAEKKPIVISENSKKLKAYYTQPSIEYKNVTGYISFIQ--PSIKFMNIIDGN 78 
87161928    1 MKMKNIAKISLLLGILATGVNTTTEKPVHAEKKPIVISENSKKLKAYYNQPSIEYKNVTGYISFIQ--PSIKFMNIIDGN 78 
150392929   1 MKMKNIAKISLLLGILATGVNTTTEKPVHAEKKPIVISENSKKLKAYYTQPSIEYKNVTGYISFIQ--PSIKFMNIIDGN 78 
15923413    1 MKMKNIAKISLLLGILATGVNTTTEKPVHAEKKPIVISENSKKLKAYYTQPSIEYKNVTGYISFIQ--PSIKFMNIIDGN 78 
21282112    1 MKMKSIVKISLLLGILATGVNTTTEKPVHAEKKPIVISENSKKLKAYYTQPSIEYKNVTGYISFIQ--PSIKFMNIIDGN 78 
57651310    1 MKMKNIAKISLLLGILATGVNTTTEKPVHAEKKPIVISENSKKLKAYYNQPSIEYKNVTGYISFIQ--PSIKFMNIIDGN 78 
88194181    1 MKMKNIAKISLLLGILATGVNTTTEKPVHAEKKPIVISENSKKLKAYYNQPSIEYKNVTGYISFIQ--PSIKFMNIIDGN 78 
151220601   1 MKMKNIAKISLLLGILATGVNTTTEKPVHAEKKPIVISENSKKLKAYYNQPSIEYKNVTGYISFIQ--PSIKFMNIIDGN 78 
156978751   1 MKMKNIAKISLLLGILATGVNTTTEKPVHAEKKPIVISENSKKLKAYYTQPSIEYKNVTGYISFIQ--PSIKFMNIIDGN 78 
49482651   81 TVNNLALVGKDKEHYHTGVHRNLDIFYVNEDKRFEGAKYSIGGITKASDKVVDQVAEARVIKEDHTGEYDYDFFPFKIDK 160
49485289   79 SVNNIALIGKDKQHYHTGVHRNLNIFYVNEDKRFEGAKYSIGGITSANDKAVDLIAEARVIKADHIGEYDYDFFPFKIDK 158
87161928   79 SVNNIALIGKDKQHYHTGVHRNLNIFYVNEDKRFEGAKYSIGGITSANDKAVDLIAEARVIKEDHTGEYDYDFFPFKIDK 158
150392929  79 SVNNLALIGKDKQHYHTGVHRNLNIFYVNEDKRFEGAKYSIGGITSANDKAVDLIAEARVIKADHIGEYDYDFFPFKIDK 158
15923413   79 SVNNLALIGKDKQHYHTGVHRNLNIFYVNEDKRFEGAKYSIGGITSANDKAVDLIAEARVIKADHIGEYDYDFFPFKIVK 158
21282112   79 SVNNIALIGKDKQHYHTGVHRNLNIFYVNEDKRFEGAKYSIGGITSANDKAVDLIAEARVIKADHIGEYDYDFFPFKIDK 158
57651310   79 SVNNIALIGKDKQHYHTGVHRNLNIFYVNEDKRFEGAKYSIGGITSANDKAVDLIAEARVIKEDHTGEYDYDFFPFKIDK 158
88194181   79 SVNNIALIGKDKQHYHTGVHRNLNIFYVNEDKRFEGAKYSIGGITSANDKAVDLIAEARVIKEDHTGEYDYDFFPFKIDK 158
151220601  79 SVNNIALIGKDKQHYHTGVHRNLNIFYVNEDKRFEGAKYSIGGITSANDKAVDLIAEARVIKEDHTGEYDYDFFPFKIDK 158
156978751  79 SVNNLALIGKDKQHYHTGVHRNLNIFYVNEDKRFEGAKYSIGGITSANDKAVDLIAEARVIKADHIGEYDYDFFPFKIVK 158
49482651  161 EAMTLKEVDFKIRKHLIDHYGLYGEMSSGTVTVQMKYYGKYTIELDKKLQEDRMADIVKVIDIDRIEVKVKKA 233
49485289  159 EAMSLKEIDFKLRKYLIDNYGLYGEMSTGKITVKKKYYGKYTFELDKKLQEDRMSDVINVTDIDRIEIKVRKA 231
87161928  159 EAMSLKEIDFKLRKYLIDNYGLYGEMSTGKITVKKKYYGKYTFELDKKLQEDRMSDVINVTDIDRIEIKVIKA 231
150392929 159 EAMSLKEIDFKLRKYLIDNYGLYGEMSTGKITVKKKYYGKYTFELDKKLQEDRMSDVINVTDIDRIEIKVRKA 231
15923413  159 EAMSLKEIDFKLRKYLIDNYGLYGEMSTGKITVKKKYYGKYTFELDKKLQEDRMSDVINVTDIDRIEIKVRKA 231
21282112  159 EAMSLKEIDFKLRKYLIDNYGLYGEMSTGKITVKKKYYGKYTFELDKKLQEDRMSDVINVTDIDRIEIKVRKA 231
57651310  159 EAMSLKEIDFKLRKYLIDNYGLYGEMSTGKITVKKKYYGKYTFELDKKLQEDRMSDVINVTDIDRIEIKVIKA 231
88194181  159 EAMSLKEIDFKLRKYLIDNYGLYGEMSTGKITVKKKYYGKYTFELDKKLQEDRMSDVINVTDIDRIEIKVIKA 231
151220601 159 EAMSLKEIDFKLRKYLIDNYGLYGEMSTGKITVKKKYYGKYTFELDKKLQEDRMSDVINVTDIDRIEIKVIKA 231
156978751 159 EAMSLKEIDFKLRKYLIDNYGLYGEMSTGKITVKKKYYGKYTFELDKKLQEDRMSDVINVTDIDRIEIKVRKA 231
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap