Conserved Protein Domain Family
PRK13040

?
PRK13040: PRK13040 
superantigen-like protein SSL6; Reviewed
Statistics
?
PSSM-Id: 106077
View PSSM: PRK13040
Aligned: 6 rows
Threshold Bit Score: 323.214
Threshold Setting Gi: 88194186
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
21282116    1 MKLKALAKATLVLGLLATGVITTESQTVKAAESTQGQHNYKSLKYYYSKPSIELINVDGLYRQHLTDKGAYVWKNLKDYY 80 
88194186    1 MKLKTLAKATLVLGLLATGVITTESQTVKAAESTQGQHNYKSLKYYYSKPSIELKNLDGLYRQKVTDKGVYVWKDRKDYF 80 
151220605   1 MKLKTLAKATLVLGLLATGVITTESQTVKAAESTQGQHNYKSLKYYYSKPSIELKNLDGLYRQKVTDKGVYVWKDRKDYF 80 
87160396    1 MKLKTLAKATLVLGLLATGVITTESQTVKAAESTQGQHNYKSLKYYYSKPSIELKNLDGLYRQKVTDKGVYVWKDRKDYF 80 
49485293    1 MKLKALAKATLVLGLLATGVITTESQTVKAAESTQGQHNYKSLKYYYSKPSIELINVDGLYRQHLTDKGAYVWKNLKDYY 80 
161508675   1 MKLKTLAKATLVLGLLATGVITTESQTVKAAESTQGQHNYKSLKYYYSKPSIELKNLDGLYRQKVTDKGVYVWKDRKDYF 80 
21282116   81 IGLLGEDSKKFKSDVYGDLDAFLVIEEEPVKGRQYSIGGISKTNSKEFkEREVDVKVTRKADRDTTSTKDSKFKITKEEI 160
88194186   81 VGLLGKDIEKYPQGEHDKQDAFLVIEEETVNGRQYSIGGLSKTNSKEF-SKEVDVKVTRKIDESSEKSKDSKFKITKEEI 159
151220605  81 VGLLGKDIEKYPQGEHDKQDAFLVIEEETVNGRQYSIGGLSKTNSKEF-SKEVDVKVTRKIDESSEKSKDSKFKITKEEI 159
87160396   81 VGLLGKDIEKYPQGEHDKQDAFLVIEEETVNGRQYSIGGLSKTNSKEF-SKEVDVKVTRKIDESSEKSKDSKFKITKEEI 159
49485293   81 IGLLGEDSKKFKSDVYGDLDAFLVIEEEPVKGRQYSIGGISKTNSKEFkEREVDVKVTRKADRDTTSTKDSKFKITKEEI 160
161508675  81 VGLLGKDIEKYPQGEHDKQDAFLVIEEETVNGRQYSIGGLSKTNSKEF-SKEVDVKVTRKIDESSEKSKDSKFKITKEEI 159
21282116  161 SLKELDFKLRQKLMKEENLYDAINHRKGKIVVKMEDDKFYTFELTKKLQPHRMGDTIDGTKIKEINVELEYK 232
88194186  160 SLKELDFKLRKKLMEEEKLYGAVNNRKGKIVVKMEDDKFYTFELTKKLQPHRMGDTIDGTKIKEINVELEYK 231
151220605 160 SLKELDFKLRKKLMEEEKLYGAVNNRKGKIVVKMEDDKFYTFELTKKLQPHRMGDTIDGTKIKEINVELEYK 231
87160396  160 SLKELDFKLRKKLMEEEKLYGAVNNRKGKIVVKMEDDKFYTFELTKKLQPHRMGDTIDGTKIKEINVELEYK 231
49485293  161 SLKELDFKLRQKLMKEENLYDAINHRKGKIVVKMEDDKFYTFELTKKLQPHRMGDTIDGTKIKEINVELEYK 232
161508675 160 SLKELDFKLRKKLMEEEKLYGAVNNRKGKIVVKMEDDKFYTFELTKKLQPHRMGDTIDGTKIKEINVELEYK 231
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap