Conserved Protein Domain Family
PRK13037

?
PRK13037: PRK13037 
superantigen-like protein SSL1; Reviewed
Statistics
?
PSSM-Id: 106074
View PSSM: PRK13037
Aligned: 15 rows
Threshold Bit Score: 403.202
Threshold Setting Gi: 57651309
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
82750136    1 MKFKAIAKASLALGMLATGVITSNVQSVQAKTEVKQQSESELKHYYNKPFFERKNVTGYKYTENGKDYMEVATDHQYYQI 80 
57651309    1 MKFKAIAKASLALGMLATGVITSNVQSVQAKAEVKQQSESELKHYYNKPILERKNVTGFKYTDEGKHYLEVTVGQQHSRI 80 
49482650    1 MKFKAIAKASLALGMLATGVITSNIQSVQAKTEVKQQSEADLKLYYNGPSFEYKKVTGYGFIEGKDRFIDFIYNGQYNKI 80 
88194180    1 MKFKAIAKASLALGMLATGVITSNVQSVQAKAEVKQQSESELKHYYNKPILERKNVTGFKYTDEGKHYLEVTVGQQHSRI 80 
21282111    1 MKFKAIAKASLALGMLATGVITSNVQSVQAKTEVKQQSEADLKLYYNGPSFEYKKVTGYGFIEGKDRFIDFIYNGQYNKI 80 
151220600   1 MKFKAIAKASLALGMLATGVITSNVQSVQAKAEVKQQSESELKHYYNKPILERKNVTGFKYTDEGKHYLEVTVGQQHSRI 80 
87160089    1 MKFKAIAKASLALGMLATGVITSNVQSVQAKAEVKQQSESELKHYYNKPILERKNVTGFKYTDEGKHYLEVTVGQQHSRI 80 
148266883   1 MKFKAIAKASLALGMLATGVITSNVQSVQAKTEVKQQSESELKHYYNKPVLERKNVTGYKYTEKGKDYIDVIVDNQYSQI 80 
156978750   1 MKFKAIAKASLALGMLATGVITSNVQSVQAKTEVKQQSESELKHYYNKPVLERKNVTGYKYTEKGKDYIDVIVDNQYSQI 80 
161508669   1 MKFKAIAKASLALGMLATGVITSNVQSVQAKAEVKQQSESELKHYYNKPILERKNVTGFKYTDEGKHYLEVTVGQQHSRI 80 
82750136   81 SLLGPDKDKFKEGNNPGLDIFVVREGDSRQAANYSIGGVTKTNSQPFIDYIHTPILEIKKGKEEPQSSLYQIYKEDISLK 160
57651309   81 TLLGSDKDKFKDGENSNIDVFILREGDSRQATNYSIGGVTKSNSVQYIDYINTPILEIKKDNEDVLKDFYYISKEDISLK 160
49482650   81 SLVGSDKDKYNEEVNPDIDVFVVREGNGRQADNHSIGGVTKTNRGVYYDYIHSPILEIKKGNEEPQNSLYQIYKENISLK 160
88194180   81 TLLGSDKDKFKDGENSNIDVFILREGDSRQATNYSIGGVTKSNSVQYIDYINTPILEIKKDNEDVLKDFYYISKEDISLK 160
21282111   81 SLVGSDKDKYNEEVNPDIDVFVVREGNGRQADNHSIGGITKTNRGVYYDYIHTPILEIKKGKEEPQSSLYQIYKEDISLK 160
151220600  81 TLLGSDKDKFKDGENSNIDVFILREGDSRQATNYSIGGVTKSNSVQYIDYINTPILEIKKDNEDVLKDFYYISKEDISLK 160
87160089   81 TLLGSDKDKFKDGENSNIDVFILREGDSRQATNYSIGGVTKSNSVQYIDYINTPILEIKKDNEDVLKDFYYISKEDISLK 160
148266883  81 SLVGSDKDKFKDGDNSNIDVFILREGDSRQATNYSIGGVTKTNSQPFIDYIHTPILEIKKGKEEPQSSLYQIYKEDISLK 160
156978750  81 SLVGSDKDKFKDGDNSNIDVFILREGDSRQATNYSIGGVTKTNSQPFIDYIHTPILEIKKGKEEPQSSLYQIYKEDISLK 160
161508669  81 TLLGSDKDKFKDGENSNIDVFILREGDSRQATNYSIGGVTKSNSVQYIDYINTPILEIKKDNEDVLKDFYYISKEDISLK 160
82750136  161 ELDFKLRKQLISQSGLYSNGLKQGQITITMKDGKSHTIDLSQKLEKERMGESIDGREIQKILVEIK 226
57651309  161 ELDYRLRERAIKQHGLYSNGLKQGQITITMNDGTTHTIDLSQKLEKERMGESIDGTKINKILVEMK 226
49482650  161 ELDYRLRERAIKQHGLYSNGLKQGQITITMKDGKSHTIDLSQKLEKERMGDSIDGRQIQKILVEMK 226
88194180  161 ELDYRLRERAIKQHGLYSNGLKQGQITITMNDGTTHTIDLSQKLEKERMGESIDGTKINKILVEMK 226
21282111  161 ELDFKLRKQLISQSGLYSNGLKQGQITITMNDGTTHTIDLSQKLEKERMGESIDGRQIQKILVEMK 226
151220600 161 ELDYRLRERAIKQHGLYSNGLKQGQITITMNDGTTHTIDLSQKLEKERMGESIDGTKINKILVEMK 226
87160089  161 ELDYRLRERAIKQHGLYSNGLKQGQITITMNDGTTHTIDLSQKLEKERMGESIDGTKINKILVEMK 226
148266883 161 ELDYRLRERAIKQHGLYSNGLKQGQITITMKDGKSHTIDLSQKLEKERMGDSIDGRQIQKILVEMK 226
156978750 161 ELDYRLRERAIKQHGLYSNGLKQGQITITMKDGKSHTIDLSQKLEKERMGDSIDGRQIQKILVEMK 226
161508669 161 ELDYRLRERAIKQHGLYSNGLKQGQITITMNDGTTHTIDLSQKLEKERMGESIDGTKINKILVEMK 226
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap