Conserved Protein Domain Family
PRK13036

?
PRK13036: PRK13036 
superantigen-like protein SSL11; Reviewed
Statistics
?
PSSM-Id: 171852
View PSSM: PRK13036
Aligned: 15 rows
Threshold Bit Score: 366.965
Threshold Setting Gi: 151220612
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
49482662    1 MKLKNIAKASLALGILTTGMITTTAQPVKAseqSRLSVTSNDTQELKKYYSGTGYNFQNVSGYREKDKMNIIDGTQLNVV 80 
151220612   1 MKLKNIAKASLALGILTTGMITTTAQPVKA---STLEVRSQATQDLSEYYNRPFFEYTNQSGYKEEGKVTFTPNYQLIDV 77 
88194194    1 MKLKNIAKASLALGILTTGMITTTAQPVKA---STLEVRSQATQDLSEYYNRPFFEYTNQSGYKEEGKVTFTPNYQLIDV 77 
87160668    1 MKLKNIAKASLALGILTTGMITTTAQPVKA---STLEVRSQATQDLSEYYNRPFFEYTNQSGYKEEGKVTFTPNYQLIDV 77 
57651319    1 MKLKNIAKASLALGILTTGMITTTAQPVKA---STLEVRSQATQDLSEYYNRPFFEYTNQSGYKEEGKVTFTPNYQLIDV 77 
15926111    1 MKLKNIAKASLALGILTTGMITTTAQPVKA---STLEVRSQATQDLSEYYKGRGFELTNVTGYKYGNKVTFIDNSQQIDV 77 
21282123    1 MKLKNIAKASLALGILTTGMITTTAQPVKAieqSRLSVTSKDTQELKKYYSGTGYNFQNVSGYREGNKMNIIDGPQLNVV 80 
49485301    1 MKLKNIAKASLALGILTTGMITTTAQPVKAieqSRLSVTSKDTQELKKYYSGTGYNFQNVSGYREGNKMNIIDGPQLNVV 80 
156978762   1 MKLKNIAKASLALGILTTGMITTTAQPVKA---STLEVRSQATQDLSEYYKGRGFELTNVTGYKYGNKVTFIDNSQQIDV 77 
161508682   1 MKLKNIAKASLALGILTTGMITTTAQPVKA---STLEVRSQATQDLSEYYNRPFFEYTNQSGYKEEGKVTFTPNYQLIDV 77 
49482662   81 TLLGTDKERFKDyDYDYEGLDVFVVREGSGKQAENISIGGITKTNKNDYKDFVNNVGLEITKPTGHNTATRQAETYRINK 160
151220612  78 TLTGNEKQNF---GEDISNVDIFVVRENSDRSGNTASIGGITKTNGSNYIDKVKDVNLIITKNIDSVTSTSTSSTYTINK 154
88194194   78 TLTGNEKQNF---GEDISNVDIFVVRENSDRSGNTASIGGITKTNGSNYIDKVKDVNLIITKNIDSVTSTSTSSTYTINK 154
87160668   78 TLTGNEKQNF---GEDISNVDIFVVRENSDRSGNTASIGGITKTNGSNYIDKVKDVNLIITKNIDSVTSTSTSSTYTINK 154
57651319   78 TLTGNEKQNF---GEDISNVDIFVVRENSDRSGNTASIGGITKTNGSNYIDKVKDVNLIITKNIDSVTSTSTSSTYTINK 154
15926111   78 TLTGNEKLTVKD-DDEVSNVDVFVVREGSDKSAITTSIGGITKTNGTQHKDTVQNVNLSVSKSTGQHTTSVTSEYYSIYK 156
21282123   81 TLLGTDKERFKD-DEDYEGLDVFVVREGSGKHADNISIGGITKTNKNQYKDPVQNVNLLTSKSNGQNTASVTSEYYSINK 159
49485301   81 TLLGTDKERFKD-DEDYEGLDVFVVREGSGKHADNISIGGITKTNKNQYKDPVQNVNLLTSKSNGQNTASVTSEYYSINK 159
156978762  78 TLTGNEKLTVKD-DDEVSNVDVFVVREGSDKSAITTSIGGITKTNGTQHKDTVQNVNLSVSKSTGQHTTSVTSEYYSIYK 156
161508682  78 TLTGNEKQNF---GEDISNVDIFVVRENSDRSGNTASIGGITKTNGSNYIDKVKDVNLIITKNIDSVTSTSTSSTYTINK 154
49482662  161 EEISLKELDFKLRKHLIENHELYKTEPKDGKIRITMKGGGYYTFELNKKLQPHRMGDVIDGRNIEKIEVDL 231
151220612 155 EEISLKELDFKLRKHLIDKHNLYKTEPKDSKIRITMKDGGFYTFELNKKLQTHRMGDVIDGRNIEKIEVNL 225
88194194  155 EEISLKELDFKLRKHLIDKHNLYKTEPKDSKIRITMKDGGFYTFELNKKLQTHRMGDVIDGRNIEKIEVNL 225
87160668  155 EEISLKELDFKLRKHLIDKHNLYKTEPKDSKIRITMKDGGFYTFELNKKLQTHRMGDVIDGRNIEKIEVNL 225
57651319  155 EEISLKELDFKLRKHLIDKHNLYKTEPKDSKIRITMKDGGFYTFELNKKLQTHRMGDVIDGRNIEKIEVNL 225
15926111  157 EEISLKELDFKLRKHLIDKHDLYKTEPKDSKIRITMKNGGYYTFELNKKLQPHRMGDTIDSRNIEKIEVNL 227
21282123  160 EEISLKELDFKLRKQLIDKHDLYKTEPKDSKIKVSMKNGGYYTFELNKKLQPHRMGDTIDSRNIKKIEVNL 230
49485301  160 EEISLKELDFKLRKQLIDKHDLYKTEPKDSKIKVSMKNGGYYTFELNKKLQPHRMGDTIDSRNIKKIEVNL 230
156978762 157 EEISLKELDFKLRKHLIDKHDLYKTEPKDSKIRITMKNGGYYTFELNKKLQPHRMGDTIDSRNIEKIEVNL 227
161508682 155 EEISLKELDFKLRKHLIDKHNLYKTEPKDSKIRITMKDGGFYTFELNKKLQTHRMGDVIDGRNIEKIEVNL 225
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap