Conserved Protein Domain Family
PRK13033

?
PRK13033: PRK13033 
formyl peptide receptor-like 1 inhibitory protein; Reviewed
Statistics
?
PSSM-Id: 171849
View PSSM: PRK13033
Aligned: 14 rows
Threshold Bit Score: 239.546
Threshold Setting Gi: 82750762
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
150393703   1 MKKNITKTIIASTVIAAGLLTQTNDAKAFFSYEWKGLEIAKNLADQAKKDDERIDKLMKESDKNLTPYKAETVNDLYLIV 80 
21282767    1 MKKNITKVIIASTVIATGLLTQTNDAKAFFSYEWKGLEIAKNLADQAKKDDERADKLIKEADEKNEHYKGKTVEDLYVIA 80 
15926739    1 MKKNITKTIIASTVIAAGLLTQTNDAKAFFSYEWKGLEIAKNLADQAKKDDERIDKLMKESDKNLTPYKAETVNDLYLIV 80 
15924146    1 MKKNITKTIIASTVIAAGLLTQTNDAKAFFSYEWKGLEIAKNLADQAKKDDERIDKLMKESDKNLTPYKAETVNDLYLIV 80 
87162250    1 MKKNITKTIIASTVIAAGLLTQTNDAKAFFSYEWKGLEIAKNLADQAKKDDERIDKLMKESDKNLTPYKAETVNDLYLIV 80 
82750762    1 MKKNITKTIIASTVIAAGLLTQTNDAKAFFSYEGKGLEIAKNLADQAKKDDERIDKLMKESDKNQTPYKAETVNDLYLIV 80 
151221279   1 MKKNITKTIIASTVIAAGLLTQTNDAKAFFSYEWKGLEIAKNLADQAKKDDERIDKLMKESDKNLTPYKAETVNDLYLIV 80 
148267646   1 MKKNITKTIIASTVIAAGLLTQTNDAKAFFSYEWKGLEIAKNLADQAKKDDERIDKLMKESDKNLTPYKAETVNDLYLIV 80 
156979477   1 MKKNITKTIIASTVIAAGLLTQTNDAKAFFSYEWKGLEIAKNLADQAKKDDERIDKLMKESDKNLTPYKAETVNDLYLIV 80 
161509331   1 MKKNITKTIIASTVIAAGLLTQTNDAKAFFSYEWKGLEIAKNLADQAKKDDERIDKLMKESDKNLTPYKAETVNDLYLIV 80 
150393703  81 KKLSQGDVkKAVVRIKDGGPRDYYTFDLTRPLEENRKNIKVVKNGEIDSIYWD 133
21282767   81 KKMGKGNT-IAVVKIKDGGKNGYYTFDITRPLEEHRKNIPVVKNGEIDSITWY 132
15926739   81 KKLSQGDVkKAVVRIKDGGPRDYYTFDLTRPLEENRKNIKVVKNGEIDSIYWD 133
15924146   81 KKLSQGDVkKAVVRIKDGGPRDYYTFDLTRPLEENRKNIKVVKNGEIDSIYWD 133
87162250   81 KKLSQGDVkKAVVRIKDGGPRDYYTFDLTRPLEENRKNIKVVKNGEIDSITWY 133
82750762   81 KKLSQGDVkKAVVRIKDGGPRDYYTFDLTRPLEENRKNIKVVKNGEIDSIYWD 133
151221279  81 KKLSQGDVkKAVVRIKDDGPRDYYTFDLTRPLEENRKNIKVVKNGEIDSITWY 133
148267646  81 KKLSQGDVkKAVVRIKDGGPRDYYTFDLTRPLEENRKNIKVVKNGEIDSIYWD 133
156979477  81 KKLSQGDVkKAVVRIKDGGPRDYYTFDLTRPLEENRKNIKVVKNGEIDSIYWD 133
161509331  81 KKLSQGDVkKAVVRIKDGGPRDYYTFDLTRPLEENRKNIKVVKNGEIDSITWY 133
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap