Conserved Protein Domain Family
PRK13031

?
PRK13031: PRK13031 
preprotein translocase subunit SecB; Provisional
Statistics
?
PSSM-Id: 106068
View PSSM: PRK13031
Aligned: 9 rows
Threshold Bit Score: 274.355
Threshold Setting Gi: 89255460
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
89255460    1 MDQQAQPQFQIQKVYVKDLSFSIPNSDKIWTTNWKPELHTDLKVEATKLPEENTYETVLTLEVKVENDGMVAFEAEVKQA 80 
56708747    1 MDQQAQPQFQIQKVYVKDLSFSIPNSDKIWTTNWKPELHTDLKVEATKLPEENTYETVLTLEVKVENDGMVAFEAEVKQA 80 
118496736   1 MDQQAQPQFQIQKVYVKDLSFSIPNSDKIWTTNWKPELHTDLKVEATKLPEENTYETVLTLEVKVENDGMVAFEAEVKQA 80 
134302774   1 MDQQAQPQFQIQKVYVKDLSFSIPNSDKIWTTNWKPELHTDLKVEATKLPEENTYETVLTLEVKVENDGMVAFEAEVKQA 80 
110671219   1 MDQQAQPQFQIQKVYVKDLSFSIPNSDKIWTTNWKPELHTDLKVEATKLPEENTYETVLTLEVKVENDGMVAFEAEVKQA 80 
115313989   1 MDQQAQPQFQIQKVYVKDLSFSIPNSDKIWTTNWKPELHTDLKVEATKLPEENTYETVLTLEVKVENDGMVAFEAEVKQA 80 
156501382   1 MDQQAQPQFQIQKVYVKDLSFSIPNSDKIWTTNWKPELHTDLKVEATKLPEENTYETVLTLEVKVENDGMVAFEAEVKQA 80 
167626927   1 MDQQAQPQFQIQKVYVKDMSFSIPNSDKIWTTAWKPELHTDLKIEAINLPEENTYESILTLEVKVENEGIVAFEAEVKQA 80 
187932297   1 MDQQAQPQFQIQKVYVKDLSFSIPNSDKIWTTNWKPELHTDLKVEATKLPEENTYETVLTLEVKVENDGMVAFEAEVKQA 80 
89255460   81 GIFTVANMQEAQIEHAKKAFCPNILYHYAREAISDLVISGGFPQLCLSAVNFDAMYQDSLKESADSKQH 149
56708747   81 GIFTVANMQEAQIEHAKKAFCPNILYHYAREAISDLVISGGFPQLCLSAVNFDAMYQDSLKESADSKQH 149
118496736  81 GIFTVANMQEAQIEHAKKAFCPNILYHYAREAISDLVISGGFPQLCLSAVNFDAMYQDSLKESADSKQH 149
134302774  81 GIFTVANMQEAQIEHAKKAFCPNILYHYAREAISDLVISGGFPQLCLSAVNFDAMYQDSLKESADSKQH 149
110671219  81 GIFTVANMQEAQIEHAKKAFCPNILYHYAREAISDLVISGGFPQLCLSAVNFDAMYQDSLKESADSKQH 149
115313989  81 GIFTVANMQEAQIEHAKKAFCPNILYHYAREAISDLVISGGFPQLCLSAVNFDAMYQDSLKESADSKQH 149
156501382  81 GIFTVANMQEAQIEHAKKAFCPNILYHYAREAISDLVISGGFPQLCLSAVNFDAMYQDSLKESADSKQH 149
167626927  81 GIFTVSNMQEAQIEHAKKAFCPNILYHYAREAISDLVSSGGFPQLCLSAVNFDAMYQDSLEKPADSKQH 149
187932297  81 GIFTVANMQEAQIEHAKKAFCPNILYHYAREAISDLVISGGFPQLCLSAVNFDAMYQDSLKESADSKQH 149
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap