Conserved Protein Domain Family
PRK13023

?
PRK13023: PRK13023 
protein translocase subunit SecDF
Statistics
?
PSSM-Id: 171842
View PSSM: PRK13023
Aligned: 11 rows
Threshold Bit Score: 1281.87
Threshold Setting Gi: 153009664
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
153009664   1 MLYFSRWKSALIWLAVLVSFIIASPNFFSRETLAKLPNFLPKQQIALGLDLSGGSRLVLQVQNPGRGELERTANIMRQRL 80 
163843163  18 MLYFSRWKSALIWLAVLVSLIIASPNFFSRETLANLPDFLPKKQVSLGLDLSGGSRLILQVQNAGKIDLETTANIMRQRL 97 
161618851  18 MLYFSRWKSALIWLAVLVSLIIASPNFFSRETLANLPDFLPKKQVSLGLDLSGGSRLILQVQNAGKTDLETTANIMRQRL 97 
189024077  18 MLYFSRWKSALIWLAVLVSLIIASPNFFSRETLENLPDFLPKKQVSLGLDLSGGSRLILQVQNAGKTDLETTANIMRQRL 97 
225852404  18 MLYFSRWKSALIWLAVLVSLIIASPNFFSRETLANLPDFLPKKQVSLGLDLSGGSRLILQVQNAGKTDLETTANIMRQRL 97 
62289836    1 MLYFSRWKSALIWLAVLVSLIIASPNFFSRETLENLPDFLPKKQVSLGLDLSGGSRLILQVQNAGKTDLETTANIMRQRL 80 
23501777   28 MLYFSRWKSALIWLAVLVSLIIASPNFFSRETLANLPDFLPKKQVSLGLDLSGGSRLILQVQNAGKTDLETTANIMRQRL 107
17987359   18 MLYFSRWKSALIWLAVLVSLIIASPNFLSRETLANLPDFLPKKQVSLGLDLSGGSRLILQVQNAGKTDLETTANIMRQRL 97 
148560432  28 MLYFSRWKSALIWLAVLVSLIIASPNFFSRETLANLPDFLPKKQVSLGLDLSGGSRLILQVQNAGKTDLETTTNIMRQRL 107
82699761   28 MLYFSRWKSALIWLAVLVSLIIASPNFFSRETLENLPDFLPKKQVSLGLDLSGGSRLILQVQNAGKTDLETTANIMRQRL 107
256369319  28 MLYFSRWKSALIWLAVLVSLIIASPNFFSRETLANLPDFLPKKQVSLGLDLSGGSRLILQVQNAGKTDLETTANIMRQRL 107
153009664  81 EELGYGKPLVEEENRNQIRVEVPGVYDAQLLKDILSVRGNFSFRAVDSTMSPDDAIRGTPPADSEIIYSYDDPPVGYLVK 160
163843163  98 EELGYGNPVVEGEGRNQIRVEVPGLYDAQLLKDILTIRGNLSFRAMDDTMSPDDAIRGTPPADSEIVYSFDDPPVGYLLK 177
161618851  98 EELGYGNPVVEGEGRNQIRVEVPGLYDAQLLKDILTIRGNLSFRAMDDTMSPDDAIRGTPPADSEIVYSFDDPPVGYLLK 177
189024077  98 EELGYGNPVVEGEGRNQIRVEVPGLYDAQLLKDILTIRGNLSFRAMDDTMSPDDAIRGTPPADSEIVYSFDDPPVGYLLK 177
225852404  98 EELGYGNPVVEGEGRNQIRVEVPGLYDAQLLKDILTIRGNLSFRAMDDTMSPDDAIRGTPLADSEIVYSFDDPPVGYLLK 177
62289836   81 EELGYGNPVVEGEGRNQIRVEVPGLYDAQLLKDILTIRGNLSFRAMDDTMSPDDAIRGTPPADSEIVYSFDDPPVGYLLK 160
23501777  108 EELGYGNPVVEGEGRNQIRVEVPGLYDAQLLKDILTIRGNLSFRAMDDTMSPDDAIRGTPPADSEIVYSFDDPPVGYLLK 187
17987359   98 EELGYGNPVVEGEGRNQIRVEVPGLYDAQLLKDILTIRGNLSFRAMDDTMSPDDAIRGTPLADSEIVYSFDDPPVGYLLK 177
148560432 108 EELGYGNPVVEGEGRNQIRVEVPGLYDAQLLKDILTIRGNLSFRAMDDTMSPDDAIRGTPPADSEIVYSFDDPPVGYLLK 187
82699761  108 EELGYGNPVVEGEGRNQIRVEVPGLYDAQLLKDILTIRGNLSFRAMDDTMSPDDAIRGTPPADSEIVYSFDDPPVGYLLK 187
256369319 108 EELGYGNPVVEGEGRNQIRVEVPGLYDAQLLKDILTIRGNLSFRAMDDTMSPDDAIRGTPPADSEIVYSFDDPPVGYLLK 187
153009664 161 KQPILTGANVTDAKATLSDDDSEPVITLTLDDAGRKNLAEATSHLVGGSFAIVVDNQIVSAPAVDEKLDTNELQISGAFD 240
163843163 178 KTPILTGHDITDAKASISADDGQPVITLTLDDNGRRRLADLTAQGNENSFAIVVDNQVVSAPTVSGPLDTSELQIEGAFD 257
161618851 178 KTPILTGHDITDAKASISADDGQPVITLTLDDNGRRRLADLTAQGNENSFAIVVDNQVVSAPTVSGPLDTSELQIEGAFD 257
189024077 178 KTPILTGHDITDAKASISADDGQPVITLTLDDNGRRRLADLTAQGNENSFAIVVDNQVVSAPTVSGPLDTSELQIEGAFD 257
225852404 178 KTPILTGHDITDAKASISADDGQPVITLTLDDNGRRRLADLTAQGNENSFAIVVDNQVVSAPTVSGPLDTSELQIEGAFD 257
62289836  161 KTPILTGHDITDAKASISADDGQPVITLTLDDNGRRRLADLTAQGNENSFAIVVDNQVVSAPTVSGPLDTSELQIEGAFD 240
23501777  188 KTPILTGHDITDAKASISADDGQPVITLTLDDNGRRRLADLTAQGNENSFAIVVDNQVVSAPTVSGPLDTSELQIEGAFD 267
17987359  178 KTPILTGHDITDAKASISADDGQPVITLTLDDNGRRRLADLTAQGNENSFAIVVDNQVVSAPTVSGPLDTSELQIEGAFD 257
148560432 188 KTPILTGHDITDAKASISADDGQPVITLTLDDNGRRRLADLTAQGNENSFAIVVDNQVVSAPTVSGPLDTSELQIEGAFD 267
82699761  188 KTPILTGHDITDAKASISADDGQPVITLTLDDNGRRRLADLTAQGNENSFAIVVDNQVVSAPTVSGPLDTSELQIEGAFD 267
256369319 188 KTPILTGHDITDAKASISADDGQPVITLTLDDNGRRRLADLTAQGNENSFAIVVDNQVVSAPTVSGPLDTSELQIEGAFD 267
153009664 241 LQAANNMAVVLRSGALPQDVTVLEERTIASALGEDYASAAALAALLAALLVGLFMVLSYGILGVIAMVALAVNIIILTAI 320
163843163 258 LQAANNMAVVLRSGALPQAVTVLEERTIASALGEDYASAAVLAALLAALVVGLFMVLSYGILGVIALVALVVNIIILTAV 337
161618851 258 LQAANNMAVVLRSGALPQAVTVLEERTIASALGEDYASAAVLAALLAALVVGLFMVLSYGILGVIALVALVVNIIILTAV 337
189024077 258 LQAANNMAVVLRSGALPQAVTVLEERTIASALGEDYASAAVLAALLAALVVGLFMVLSYGILGVIALVALVVNIVILTAV 337
225852404 258 LQAANNMAVVLRSGALPQAVTVLEERTIASALGEDYASAAVLAALLAALVVGLFMVLSYGILGVIALVALVVNIIILTAV 337
62289836  241 LQAANNMAVVLRSGALPQAVTVLEERTIASALGEDYASAAVLAALLAALVVGLFMVLSYGILGVIALVALVVNIVILTAV 320
23501777  268 LQAANNMAVVLRSGALPQAVTVLEERTIASALGEDYASAAVLAALLAALVVGLFMVLSYGILGVIALVALVVNIIILTAV 347
17987359  258 LQAANNMAVVLRSGALPQAVTVLEERTIASALGEDYASAAVLAALLAALVVGLFMVLSYGILGVIALVALVVNIIILTAV 337
148560432 268 LQAANNMAVVLRSGALPQAVTVLEERTIASALGEDYASAAVLAALLAALVVGLFMVLSYGILGVIALVALVVNIIILTAV 347
82699761  268 LQAANNMAVVLRSGALPQAVTVLEERTIASALGEDYASAAVLAALLAALVVGLFMVLSYGILGVIALVALVVNIVILTAV 347
256369319 268 LQAANNMAVVLRSGALPQAVTVLEERTIASALGEDYASAAVLAALLAALVVGLFMVLSYGILGVIALVALVVNIIILTAV 347
153009664 321 LSLIGASISLASIAGLVLTIGLAVDAHILIYERVREDRRKGYSVVQAMESGFYRALSTIIDANLTTLIAALVLFLLGSGT 400
163843163 338 LSLIGASISLASIAGLVLTIGLAVDAHILIYERVREDRRKGYSVVQAMESGFYRALSTIVDANLTTLIAALVLFLLGSGT 417
161618851 338 LSLIGASISLASIAGLVLTIGLAVDAHILIYERVREDRRKGYSVVQAMESGFYRALSTIVDANLTTLIAALVLFLLGSGT 417
189024077 338 LSLIGASISLASIAGLVLTIGLAVDAHILIYERVREDRRKGYSVVQAMESGFYRALSTIVDANLTTLIAALVLFLLGSGT 417
225852404 338 LSLIGASISLASIAGLVLTIGLAVDAHILIYERVREDRRKGYSVVQAMESGFYRALSTIVDANLTTLIAALVLFLLGSGT 417
62289836  321 LSLIGASISLASIAGLVLTIGLAVDAHILIYERVREDRRKGYSVVQAMESGFYRALSTIVDANLTTLIAALVLFLLGSGT 400
23501777  348 LSLIGASISLASIAGLVLTIGLAVDAHILIYERVREDRRKGYSVVQAMESGFYRALSTIVDANLTTLIAALVLFLLGSGT 427
17987359  338 LSLIGASISLASIAGLVLTIGLAVDAHILIYERVREDRRKGYSVVQAMESGFYRALSTIVDANLTTLIAALVLFLLGSGT 417
148560432 348 LSLIGASISLASIAGLVLTIGLAVDAHILIYERVREDRRKGYSVVQAMESGFYRALSTIVDANLTTLIAALVLFLLGSGT 427
82699761  348 LSLIGASISLASIAGLVLTIGLAVDAHILIYERVREDRRKGYSVVQAMESGFYRALSTIVDANLTTLIAALVLFLLGSGT 427
256369319 348 LSLIGASISLASIAGLVLTIGLAVDAHILIYERVREDRRKGYSVVQAMESGFYRALSTIVDANLTTLIAALVLFLLGSGT 427
153009664 401 VHGFALTVAVGIGTTLFTTLTFTRLLIAQWVRTAKPKEVPKRRLKLVPTVTHIPFMRLQFVTLGISVLACAIVVALFVNI 480
163843163 418 VHGFALTVAIGIGTTLFTTLTFTRLLIAQWVRTAKPKEVPKRRLKLVPTVTHIPFMRLQFVTLGISVLACAIVVALFVNI 497
161618851 418 VHGFALTVAIGIGTTLFTTLTFTRLLIAQWVRTAKPKEVPKRRLKLVPTVTHIPFMRLQFVTLGISVLACAIVVALFVNI 497
189024077 418 VHGFALTVAIGIGTTLFTTLTFTRLLIAQWVRTAKPKEVPKRRLKLVPTVTHIPFMRLQFVTLGISVLACAIVVALFVNI 497
225852404 418 VHGFALTVAIGIGTTLFTTLTFTRLLIAQWVRTAKPKEVPKRRLKLVPTVTHIPFMRLQFVTLGISVLACAIVVALFVNI 497
62289836  401 VHGFALTVAIGIGTTLFTTLTFTRLLIAQWVRTAKPKEVPKRRLKLVPTVTHIPFMRLQFVTLGISVLACAIVVALFVNI 480
23501777  428 VHGFALTVAIGIGTTLFTTLTFTRLLIAQWVRTAKPKEVPKRRLKLVPTVTHIPFMRLQFVTLGISVLACAIVVALFVNI 507
17987359  418 VHGFALTVAIGIGTTLFTTLTFTRLLIAQWVRTAKPKEVPKRRLKLVPTVTHIPFMRLQFVTLGISVLACAIVVALFVNI 497
148560432 428 VHGFALTVAIGIGTTLFTTLTFTRLLIAQWVRTAKPKEVPKRRLKLVPTVTHIPFMRLQFVTLGISVLACAIVVALFVNI 507
82699761  428 VHGFALTVAIGIGTTLFTTLTFTRLLIAQWVRTAKPKEVPKRRLKLVPTVTHIPFMRLQFVTLGISVLACAIVVALFVNI 507
256369319 428 VHGFALTVAIGIGTTLFTTLTFTRLLIAQWVRTAKPKEVPKRRLKLVPTVTHIPFMRLQFVTLGISVLACAIVVALFVNI 507
153009664 481 GFNYGIDFRGGSMVELQARSGDANIEDITERLTELNIDSARVLPAKSPRSALVIIGSQEVGDDAEQTVAVKLRGEFEPDY 560
163843163 498 GFNYGIDFRGGSMVELQARNGDANLEDINERLAELNIDSTRVLPAKSPRSALVIIGSQEVGDDAEQTVAVKLRGEFEQDY 577
161618851 498 GFNYGIDFRGGSMVELQARNGDANLEDINERLAELNIDSARVLPAKSPRSALVIIGSQEVGDDAEQTVAVKLRGEFEQDY 577
189024077 498 GFNYGIDFRGGSMVELQARNGDANLEDINERLAELNIDSARVLPAKSPRSALVIIGSQEVGDDAEQTVAVKLRGEFEQDY 577
225852404 498 GFNYGIDFRGGSMVELQARNGDANLEDINERLAELNIDSARVLPAKSPRSALVIIGSQEVGDDAEQTVAVKLRGEFEQDY 577
62289836  481 GFNYGIDFRGGSMVELQARNGDANLEDINERLAELNIDSARVLPAKSPRSALVIIGSQEVGDDAEQTVAVKLRGEFEQDY 560
23501777  508 GFNYGIDFRGGSMVELQARNGDANLEDINERLAELNIDSARVLPAKSPRSALVIIGSQEVGDDAEQTVAVKLRGEFEQDY 587
17987359  498 GFNYGIDFRGGSMVELQARNGDANLEDINERLAELNIDSARVLPAKSPRSALVIIGSQEVGDDAEQTVAVKLRGEFEQDY 577
148560432 508 GFNYGIDFRGGSMVELQARNGDANLEDINERLAELNIDSARVLPAKSPRSALVIIGSQEVGDDAEQTVAVKLRGEFEQDY 587
82699761  508 GFNYGIDFRGGSMVELQARNGDANLEDINERLAELNIDSARVLPAKSPRSALVIIGSQEVGDDAEQTVAVKLRGEFEQDY 587
256369319 508 GFNYGIDFRGGSMVELQARNGDANLEDINERLAELNIDSARVLPAKSPRSALVIIGSQEVGDDAEQTVAVKLRGEFEQDY 587
153009664 561 SFQRVEVVGPTVSEQLSRAGVLAVILSLIGIFIYVWVRFRWQLALGAVLSTLHDVIILAGMFIVFRMEFNLWSVAAILTI 640
163843163 578 SFQRVDVVGPTVSEQLSRAGVLAVILSLIGIFIYVWFRFRWQLALGAVLSTLHDVVILSGMFIVFRMEFNLWSVAAILTI 657
161618851 578 SFQRVDVVGPTVSEQLSRAGVLAVILSLIGIFIYVWFRFRWQLALGAVLSTLHDVVILSGMFIVFRMEFNLWSVAAILTI 657
189024077 578 SFQRVDVVGPTVSEQLSRAGVLAVILSLIGIFIYVWFRFRWQLALGAVLSTLHDVVILSGMFIVFRMEFNLWSVAAILTI 657
225852404 578 SFQRVDVVGPTVSEQLSRAGVLAVILSLIGIFIYVWFRFRWQLALGAVLSTLHDVVILSGMFIVFRMEFNLWSVAAILTI 657
62289836  561 SFQRVDVVGPTVSEQLSRAGVLAVILSLIGIFIYVWFRFRWQLALGAVLSTLHDVVILSGMFIVFRMEFNLWSVAAILTI 640
23501777  588 SFQRVDVVGPTVSEQLSRAGVLAVILSLIGIFIYVWFRFRWQLALGAVLSTLHDVVILSGMFIVFRMEFNLWSVAAILTI 667
17987359  578 SFQRVDVVGPTVSEQLSRAGVLAVILSLIGIFIYVWFRFRWQLALGAVLSTLHDVVILSGMFIVFRMEFNLWSVAAILTI 657
148560432 588 SFQRVDVVGPTVSEQLSRAGVLAVILSLIGIFIYVWFRFRWQLALGAVLSTLHDVVILSGMFIVFRMEFNLWSVAAILTI 667
82699761  588 SFQRVDVVGPTVSEQLSRAGVLAVILSLIGIFIYVWFRFRWQLALGAVLSTLHDVVILSGMFIVFRMEFNLWSVAAILTI 667
256369319 588 SFQRVDVVGPTVSEQLSRAGVLAVILSLIGIFIYVWFRFRWQLALGAVLSTLHDVVILSGMFIVFRMEFNLWSVAAILTI 667
153009664 641 IGYSLNDTVVIYDRVRENLRVYKSAPLPAIIDASINQTLSRTLLTSFVTFLAHIPLYAFGGADIRSFALALSVGIIVASY 720
163843163 658 IGYSLNDTVVIYDRVRENLRRYKSAPLPAIIDASINQTLSRTLLTSFVTFLAHVPLYAFGGSEIRMFALALSVGIIVASY 737
161618851 658 IGYSLNDTVVIYDRVRENLRRYKSAPLPAIIDASINQTLSRTLLTSFVIFLAHVPLYAFGGSEIRMFALALSVGIIVASY 737
189024077 658 IGYSLNDTVVIYDRVRENLRRYKSAPLPAIIDASINQTLSRTLLTSFVTFLAHVPLYAFGGSEIRMFALALSVGIIVASY 737
225852404 658 IGYSLNDTVVIYDRVRENLRRYKSAPLPAIIDASINQTLSRTLLTSFVTFLAHVPLYAFGGSEIRMFALALSVGIIVASY 737
62289836  641 IGYSLNDTVVIYDRVRENLRRYKSAPLPAIIDASINQTLSRTLLTSFVTFLAHVPLYAFGGSEIRMFALALSVGIIVASY 720
23501777  668 IGYSLNDTVVIYDRVRENLRRYKSAPLPAIIDASINQTLSRTLLTSFVTFLAHVPLYAFGGSEIRMFALALSVGIIVASY 747
17987359  658 IGYSLNDTVVIYDRVRENLRRYKSAPLPAIIDASINQTLSRTLLTSFVTFLAHVPLYAFGGSEIRMFALALSVGIIVASY 737
148560432 668 IGYSLNDTVVIYDRVRENLRRYKSAPLPAIIDASINQTLSRTLLTSFVTFLAHVPLYAFGGSEIRMFALALSVGIIVASY 747
82699761  668 IGYSLNDTVVIYDRVRENLRRYKSAPLPAIIDASINQTLSRTLLTSFVTFLAHVPLYAFGGSEIRMFALALSVGIIVASY 747
256369319 668 IGYSLNDTVVIYDRVRENLRRYKSAPLPAIIDASINQTLSRTLLTSFVTFLAHVPLYAFGGSEIRMFALALSVGIIVASY 747
153009664 721 SSIFIAAPLLVQFGLKPRGPDeSSDQMDDELAQSLNLES 759
163843163 738 SSIFIAAPLLVQFGLKSRETD-AGDAVDAELAQSLNLES 775
161618851 738 SSIFIAAPLLVQFGLKPRETD-AGDAVDAELAQSLNLES 775
189024077 738 SSIFIAAPLLVQFGLKPRETD-AGDAVDAELAQSLNLES 775
225852404 738 SSIFIAAPLLVQFGLKPRETD-AGDAVDAELAQSLNLES 775
62289836  721 SSIFIAAPLLVQFGLKPRETD-AGDAVDAELAQSLNLES 758
23501777  748 SSIFIAAPLLVQFGLKPRETD-AGDAVDAELAQSLNLES 785
17987359  738 SSIFIAAPLLVQFGLKPRETD-AGDAVDAELAQSLNLES 775
148560432 748 SSIFIAAPLLVQFGLKPRETD-AGDAVDAELAQSLNLES 785
82699761  748 SSIFIAAPLLVQFGLKPRETD-AGDAVDAELAQSLNLES 785
256369319 748 SSIFIAAPLLVQFGLKPRETD-AGDAVDAELAQSLNLES 785
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap