Conserved Protein Domain Family
purU

?
PRK13010: purU 
formyltetrahydrofolate deformylase; Reviewed
Statistics
?
PSSM-Id: 139334
View PSSM: PRK13010
Aligned: 5 rows
Threshold Bit Score: 508.567
Threshold Setting Gi: 26988670
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
186472152   1 MPATDRHPQFALTLSCPSAAGQVAAIVGFLDRHHCYIDELTVFDDDISERFFVRCVFHgvgSAPDAALHIDTLRHEFRPI 80 
17545825    1 MDALSRSPSFILTLSCPSAPGQVAAVVGLLERHHCYIDELTVFDDDLNHRFFVRCVFH---PTDAHALPVDVLRQEFAPI 77 
15889735    1 ------MTSYVLTVACKSTRGIVAAISGYLAEKGCNIVDSSQFDDLETGKFFMRVSFI-----SEEGASLQAITEGFQPV 69 
71281589    2 SDIKPVSQTHIITADCPSRPGTVDVVTRFLCEKGFYINEIHSFDDTAVNRFFIRIEFR---AQTATDFSAETFSQEFEQR 78 
26988670    1 ---MNKNNQYVLSLACQDAPGIVSEVSTFLFNNGANIVEAEQFNDEDSSKFFMRVSVE------IPVAGVNDFNSAFGKV 71 
186472152  81 AADFDMTWAMHDLEMRPKVLIMVSKLEHCLADLLFRWRMGELKMDIAGIASNHP-DFQPLAAQHGLPFHHFPLTPDTKAQ 159
17545825   78 AEAFDMQWAIHDAQARPKVLIMVSKLEHCLADLLFRWRMGELKMDIVGIASNHP-DLEPLARQHDLPFRHFPIAPETKAQ 156
15889735   70 SEKFGMASDIYPDGQRMKAMLMVSRFGHCLNDLLYRWKIGALPIDIVGVVSNHF-DYQKVVVNHDIPFHHIKVTKENKPK 148
71281589   79 ASEFEMQWQLASSPYKSKVVIMVSKHDHCLNDLLYRYRTGDLDIEIPAIISNHP-DLEELAKWHGIPYYHLPITKDTKPE 157
26988670   72 VEKYNAEWWFRPRTDRKKVVIMVSKFDHCLGDLLYRHRLGELDMEVVGIISNHPrEALSVSLVGDIPFHYLPVTPATKAA 151
186472152 160 QEAQILDLFDKSGAELMILARYMQILSDETSRKLSGRAINIHHSFLPGFKGARPYHQAHARGVKLIGATAHFVTDDLDEG 239
17545825  157 QEAQWLDLFESSGAELVILARYMQVLSAQTSKKLVNRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEG 236
15889735  149 AEAQLMDLIETSGTELVVLARYMQVLSDEMCRKMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTGDLDEG 228
71281589  158 QEAKVWQIIQESDADLVVLARYMQVLSSDLCQKLSGKAINIHHSLLPGFKGARPYFQAYDRGIKLVGATAHYVSDDLDEG 237
26988670  152 QESQIKNIVTQSQADLIVLARYMQILSDDLSAFLSGRCINIHHSFLPGFKGAKPYHQAHTRGVKLIGATAHFVTADLDEG 231
186472152 240 PIIEQEVQRVDHSYGPERMLAVGRDVECITLARAVKAFVERRVFINGDRTVVL 292
17545825  237 PIIEQVVERVDHSYRPEHLLAVGRDVECLTLARAVKAFIERRVFLNADRTVVF 289
15889735  229 PIIEQDTVRVTHAQSAEDYVSLGRDVESQVLARAIHAHIHHRTFINGNRTVVF 281
71281589  238 PIISQGVETVDHGYYPKDLAAKGRDIECLTLSRAVRCHIEHRIFMYGKKTVVF 290
26988670  232 PIIAQDVEHVSHRDSAEDLVRKGRDIERRVLSRAVLLFLEDRLIVNGERTVVF 284
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap