Conserved Protein Domain Family
ulaA

?
PRK12996: ulaA 
PTS ascorbate transporter subunit IIC
Statistics
?
PSSM-Id: 171824
View PSSM: PRK12996
Aligned: 21 rows
Threshold Bit Score: 669.322
Threshold Setting Gi: 218548250
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
161936251   3 MFILETLNFVVDILKVPSVLVGLIALIGLVAQKKAFSDVVKGTIKTILGFIVLGGGATVLVGSLNPLGGMFEHAFNIQGI 82 
162139567   3 MFILETLNFVVDILKVPSVLVGLIALIGLVAQKKAFSDVVKGTIKTILGFIVLGGGATVLVGSLNPLGGMFEHAFNIQGI 82 
162286711   3 MFILETLNFVVDILKVPSVLVGLIALIGLVAQKKPFSDVVKGTIKTILGFIVLGGGATVLVGSLNPLGGMFEHAFNIQGI 82 
161502514   1 MFILETLNFVVDILKVPSVLVGLIALIGLVAQKKAFSDVVKGTIKTILGFIVLGGGATVLVGSLNPLGGMFEHAFNIQGI 80 
194735701   1 MFILETLNFVVDILKVPSVLVGLIALIGLVAQKKAFSDVVKGTIKTILGFIVLGGGATVLVGSLNPLGGMFEHAFNIQGI 80 
197361695   1 MFILETLNFVVDILKVPSVLVGLIALIGLVAQKKAFSDVVKGTIKTILGFIVLGGGATVLVGSLNPLGGMFEHAFNIQGI 80 
197251798   1 MFILETLNFVVDILKVPSVLVGLIALIGLVAQKKAFSDVVKGTIKTILGFIVLGGGATVLVGSLNPLGGMFEHAFNIQGI 80 
218548250   3 MFILETLNFVVDILKVPSVLVGLIALIGLVAQKKAFSDVVKGTIKTILGFIVLGGGATVLVGSLNPLGSMFEHAFNIQGI 82 
224583170   3 MFILETLNFVVDILKVPSVLVGLIALIGLVAQKKAFSDVVKGTIKTILGFIVLGGGATVLVGSLNPLGGMFEHAFNIQGI 82 
283786369   1 MFILETLNFVVDILKVPSVLVGLIALIGLVAQKKAFSDVVKGTIKTILGFIVLGGGATVLVGSLNPLGGMFEHAFTIQGI 80 
161936251  83 IPNNEAIVSIALEKYGASTALIMAFGMVANIVVARFTRLKYIFLTGHHTFYMACMIGVILTVAGFEGVGLVFTGSLILGL 162
162139567  83 IPNNEAIVSIALEKYGASTALIMAFGMVANIVVARFTRLKYIFLTGHHTFYMACMIGVILTVAGFEGVGLVFTGSLILGL 162
162286711  83 IPNNEAIVSIALEKYGASTALIMAFGMVANIIVARFTRLKYIFLTGHHTFYMACMIGVILTVAGFEGVGLVFTGSLILGL 162
161502514  81 IPNNEAIVSIALEKYGASTALIMAFGMVANIVVARFTRLKYIFLTGHHTFYMACMIGVILTVAGFEGVGLVFTGSLILGL 160
194735701  81 IPNNEAIVSIALEKYGASTALIMAFGMVANIVVARFTRLKYIFLTGHHTFYMACMIGVILTVAGFEGVGLVFTGSLILGL 160
197361695  81 IPNNEAIVSIALEKYGASTALIMAFGMVANIVVARFTRLKYIFLTGHHTFYMACMIGVILTVAGFEGVGLVFTGSLILGL 160
197251798  81 IPNNEAIVSIALEKYGASTALIMAFGMVANIVVARFTRLKYIFLTGHHTFYMACMIGVILTVAGFEGVGLVFTGSLILGL 160
218548250  83 IPNNEAIVSIALEKYGASTALIMAFGMVANIIVARFTRLKYIFLTGHHTFYMACMIGVILTVAGFEGVSLVFTGSLILGL 162
224583170  83 IPNNEAIVSIALEKYGASTALIMAFGMVANIVVARFTRLKYIFLTGHHTFYMACMIGVILTVAGFEGVGLVFTGSLILGL 162
283786369  81 IPNNEAIVSIALEKYGASTALIMAFGMVANILVARFTRLKYIFLTGHHTFYMACMIGVILTVAGFNGVGLVFTGSLILGL 160
161936251 163 VMAFFPALAQRYMRRITGTDDIAFGHFGTLGYVLSGWIGSLCGKGSRSTEEMNLPKNLSFLRDSSISISLTMMIIYLIMA 242
162139567 163 VMAFFPALAQRYMRRITGTDDIAFGHFGTLGYVLSGWIGSLCGKGSRSTEEMNLPKNLSFLRDSSISISLTMMIIYLIMA 242
162286711 163 VMAFFPAIAQRYMKRITGNDDIAFGHFGTLGYVLSGWIGSKCGKGSRSTEEMNLPKNLSFLRDSSISISLTMMIIYLIMA 242
161502514 161 VMAFFPALAQRYMRQITGTDDIAFGHFGTLGYVLSGWIGSLCGKGSRSTEEMNLPKNLSFLRDSSISISLTMMIIYLIMA 240
194735701 161 VMAFFPALAQRYMRRITGTDDIAFGHFGTLGYVLSGWIGSLCGKGSRSTEEMNLPKNLSFLRDSSISISLTMMIIYLIMA 240
197361695 161 VMAFFPALAQRYMRRITGTDDIAFGHFGTLGYVLSGWIGSLCGKGSRSTEEMNLPKNLSFLRDSSISISLTMMIIYLIMA 240
197251798 161 VMAFFPALAQRYMRRITGTDDIAFGHFGTLGYVLSGWIGSLCGKGSRSTEEMNLPKNLSFLRDSSISISLTMMIIYLIMA 240
218548250 163 VMAFFPALAQRYMRRITGNDEIAFGHFGTLGYVLSGWIGSVCGKGSRSTEEMNLPKNLSFLRDSSISISLTMMVIYLIMA 242
224583170 163 VMAFFPALAQRYMRRITGTDDIAFGHFGTLGYVLSGWIGSLCGKGSRSTEEMNLPKNLSFLRDSSISISLTMMIIYLIMA 242
283786369 161 VMAFFPALAQRYMRRITGNDEIAFGHFGTLGYVLSGWIGSVCGKGSRSTEEMNLPKNLSFLRDSSISISLTMMIIYLIMA 240
161936251 243 VSAGREYVEATFSGGQNYLVYAIIMAITFAAGVFIILQGVRLILAEIVPAFTGFSEKLVPNARPALDCPVVYPYAPNAVL 322
162139567 243 VSAGREYVEATFTAGKTILVYAIIMAITFAAGVFIILQGVRLILAEIVPAFTGFSEKLVPNARPALDCPVVYPYAPNAVL 322
162286711 243 VSAGREYVESTYSGGQNYLVYAIIMAITFAAGVFIILQGVRLILAEIVPAFTGFSEKLVPNARPALDCPVVYPYAPNAVL 322
161502514 241 VSAGRDYVEATFSGGQNYLVYAIIMAITFAAGVFIILQGVRLILAEIVPAFTGFSEKLVPNARPALDCPVVYPYAPNAVL 320
194735701 241 VSAGREYVEATFSGGQNYLVYAIIMAITFAAGVFIILQGVRLILAEIVPAFTGFSEKLVPNARPALDCPVVYPYAPNAVL 320
197361695 241 VSAGREYVEATFSGGQNYLVYAIIMAITFAAGVFIILQGVRLILAEIVPAFTGFSEKLVPNARPALDCPVVYPYAPNAVL 320
197251798 241 VSAGREYVEATFSGGQNYLVYAIIMAITFAAGVFIILQGVRLILAEIVPAFTGFSEKLVPNARPALDCPVVYPYAPNAVL 320
218548250 243 ISAGREYVESQFSGGQNYLVYAIIMAITFAAGVFIILQGVRLILAEIVPAFTGFSEKLVPNARPALDCPVVYPYAPNAVL 322
224583170 243 VSAGREYVEATFSGGQNYLVYAIIMAITFAAGVFIILQGVRLILAEIVPAFTGFSEKLVPNARPALDCPVVYPYAPNAVL 322
283786369 241 LSAGREYVEGTFSGGQNYLVYAIIMAITFAAGVFIILQGVRLILAEIVPAFTGFSEKLVPNARPALDCPVVYPYAPNAVL 320
161936251 323 IGFLFSFLGGLVGLFLLGQMKLVLILPGVVPHFFTGATAGVFGNATGGRRGAMIGAFANGLLITFLPVLLLPVLGAIGFA 402
162139567 323 IGFLFSFLGGLVGLFLLGQMKLVLILPGVVPHFFTGATAGVFGNATGGRRGAMIGAFANGLLITFLPVLLLPVLGAIGFA 402
162286711 323 IGFLFSFLGGLVGLLICGQLNWVLILPGVVPHFFTGATAGVFGNATGGRRGAMIGAFANGLLITFLPVLLLPVLGAIGFS 402
161502514 321 IGFLFSFLGGLVGLFLLGQMKLVLILPGVVPHFFTGATAGVFGNATGGRRGAMIGAFANGLLITFLPVLLLPVLGAIGFA 400
194735701 321 IGFLFSFLGGLVGLFLLGQMKLVLILPGVVPHFFTGATAGVFGNATGGRRGAMIGAFANGLLITFLPVLLLPVLGAIGFA 400
197361695 321 IGFLFSFLGGLVGLFLLGQMKLVLILPGVVPHFFTGATAGVFGNATGGRRGAMIGAFANGLLITFLPVLLLPVLGAIGFA 400
197251798 321 IGFLFSFLGGLVGLFLLGQMKLVLILPGVVPHFFTGATAGVFGNATGGRRGAMIGAFANGLLITFLPVLLLPVLGAIGFA 400
218548250 323 IGFLFSFLGGLVGLFLLGQMKLVLILPGVVPHFFTGATAGVFGNATGGRRGAMIGAFANGLLITFLPVLLLPVLGAIGFA 402
224583170 323 IGFLFSFLGGLVGLFLLGQMKLVLILPGVVPHFFTGATAGVFGNATGGRRGAMIGAFANGLLITFLPVLLLPVLGAIGFA 402
283786369 321 IGFLFSFLGGLVGLFLLGQMKLVLILPGVVPHFFTGATAGVFGNATGGRRGAMIGAFANGLLITFLPVLLLPVLGAIGFA 400
161936251 403 NTTFSDADFGVIGILLGNLARYLSPMAITGLVVALFALLVAYNVLAKSKKATAEVQENSGAKE 465
162139567 403 NTTFSDADFGVIGILLGNLARYLSPMAITGLVVALFALLVAYNVLAKNKKANAEVQENSGAKE 465
162286711 403 NTTFSDADFGAVGILLGNLARYLSPFAITGLVVAVFALLVAYNVFAKNKSAGGNAQENTGAKS 465
161502514 401 NTTFSDADFGAIGILLGNLARYLSPMAITGLVVALFALLVAYNVLAKNKKANAEVQENSGAKE 463
194735701 401 NTTFSDADFGVIGILLGNLARYLSPMAITGLVVALFALLVAYNVLAKNKKANAEVQENSGAKE 463
197361695 401 NTTFSDADFGVIGILLGNLARYLSPMAITGLVVALFALLVAYNVLAKSKKATAEVQENSGAKE 463
197251798 401 NTTFSDADFGVIGILLGNLARYLSPMAITGLVVALFALLVAYNVLAKNKKANAEVQENSGAKE 463
218548250 403 NTTFSDADFGAVGIVLGNLARYLSPFAITGLVVAVFVLLVAWNIFANNKLA-AKAQEKSGAKS 464
224583170 403 NTTFSDADFGVIGILLGNLARYLSPMAITGLVVALFALLVAYNVLAKNKKANAEVQENSGAKE 465
283786369 401 NTTFSDADFGVVGIVLGNLARYLSPFAISGLVVALFALLVAWNLLAKSRTA-VKTPEKNGAKS 462
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap