Conserved Protein Domain Family
PRK12938

?
PRK12938: PRK12938 
3-ketoacyl-ACP reductase
Statistics
?
PSSM-Id: 171822
View PSSM: PRK12938
Aligned: 34 rows
Threshold Bit Score: 486.442
Threshold Setting Gi: 238027094
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
76811242    3 MSQRIAYVTGGMGGIGTSICQRLHKDGFRVVAGCGPNSPRRVKWLEDQKALGFDFYASEGNVGDWDSTKQAFDKVKAEVG 82 
113867453   1 MTQRIAYVTGGMGGIGTAICQRLAKDGFRVVAGCGPNSPRREKWLEQQKALGFDFIASEGNVADWDSTKTAFDKVKSEVG 80 
17546352    1 MTKRIAYVTGGMGGIGTAICQRLARDDFIVVAGCGPNSPRKDKWLEQQRELGFDFIASEGNVADWDSSKAAFDKVKAEVG 80 
73541043    1 MTQRIAYVTGGMGGIGTAICQRLAKDGFRVVAGCGPNSPRRERWIEQQKALGFDFVASEGNVADWDSTKTAFDKVKAEVG 80 
94310300    1 MTQRIAYVTGGMGGIGTAICQRLARDGYKVVAGCGPNSPRREKWLEQQRALGFEFVASEGNVADWDSTKAAFDKVKSEVG 80 
187928994   1 MTKRIAYVTGGMGGIGTAICQRLARDGFTVVAGCGPNSPRKAKWLEQQKALGFDFVPSEGNVGDWESTKAAFDKVKAEVG 80 
186475736   1 MSQRIAYVTGGMGGIGTSICQRLHKDGFKVIAGCGPNSPRRVKWLEDQKALGFDFVASEGNVGDWESTKAAFDKVKAEVG 80 
194289469   1 MTQRIAYVTGGMGGIGTAICQRLARDGFRVVAGCGPNSPRREKWLEQQKALGFDFVASEGNVADWDSTKAAFDKVKAEVG 80 
238027094   1 MTQRIAYVTGGMGGIGTGICQRLHKAGFQVVAGCGPNSPRRVKWLEDQKALGFDFYASEGNVGDWESTKLAFDKVKAEVG 80 
300691376   1 MTKRIAYVTGGMGGIGTAICQRLARDEFIVVAGCGPNSPRKDKWLEQQRELGFDFIASEGNVADWDSTKTAFDKVKAEVG 80 
76811242   83 EIDVLVNNAGITRDVVFRKMTREDWQAVIDTNLTSLFNVTKQVIDGMVERGWGRIINISSVNGQKGQFGQTNYSTAKAGI 162
113867453  81 EVDVLINNAGITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMADRGWGRIVNISSVNGQKGQFGQTNYSTAKAGL 160
17546352   81 EVDVLINNAGITRDVVFRKMTRSDWDAVIGTNLTSLFNVTKQVIDGMVDRGWGRIVNISSVNGQKGQFGQTNYSTAKAGL 160
73541043   81 EVDVLINNAGITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMVDRGWGRIVNISSVNGQKGQFGQTNYSTAKAGL 160
94310300   81 EVDVLINNAGITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMADRGWGRIVNISSVNGQKGQFGQTNYSTAKAGL 160
187928994  81 EVDVLINNAGITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMADRGWGRIINISSVNGQKGQFGQTNYSTAKAGL 160
186475736  81 EIDVLVNNAGITRDVVFRKMTHEDWTAVIDTNLTSLFNVTKQVIDGMVERGWGRVINISSVNGQKGQFGQTNYSTAKAGI 160
194289469  81 EVDVLINNAGITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMADRGWGRIVNISSVNGQKGQFGQTNYSTAKAGL 160
238027094  81 EVDVLVNNAGITRDVVFRKMTLEDWQAVIDTNLTSLFNVTKQVIDGMVERGWGRIINISSVNGQKGQFGQTNYSTAKAGI 160
300691376  81 EVDVLVNNAGITRDVVFRKMTRADWDAVIGTNLTSLFNVTKQVIDGMVDRGWGRIVNISSVNGQKGQFGQTNYSTAKAGL 160
76811242  163 HGFTMSLAQEVATKGVTVNTVSPGYIGTDMVKAIRPDVLEKIVATIPVRRLGSPDEIGSIVAWLASEESGFSTGADFSLN 242
113867453 161 HGFTMALAQEVATKGVTVNTVSPGYIATDMVKAIRQDVLDKIVATIPVKRLGLPEEIASICAWLSSEESGFSTGADFSLN 240
17546352  161 HGFTMALAQEVATKGVTVNTVSPGYIATDMVKAIRQDVLDKIIGTIPVKRLGDPNEIASICAWLASEESGFSTGADFSLN 240
73541043  161 HGFTMALAQEVATKGVTVNTVSPGYIATDMVKAIRQDVLDKIVGTIPVKRLGEPSEIASICAWLSSDESGFSTGADFSLN 240
94310300  161 HGFTMALAQEVATKGVTVNTVSPGYIATDMVKSIRQDVLDKIVGTIPVKRLGTPEEIASICAWLSSDESGFSTGADFSLN 240
187928994 161 HGFTMALAQEVATKGVTVNTVSPGYIATDMVKAIRQDVLDKIIGTIPVKRLGEPTEIASICAWLASEESGFSTGADFSLN 240
186475736 161 HGFTMALAQEVATKGVTVNTVSPGYIGTDMVKSIRADVLEKIVATIPVRRLGTPDEIGSIVAWLASDESGFSTGADFSLN 240
194289469 161 HGFTMALAQEVATKGVTVNTVSPGYIATDMVKAIRQDVLDKIVGTIPVKRLGEPEEIASICAWLASEESGFSTGADFSLN 240
238027094 161 HGFTMSLAQEVATKGVTVNTVSPGYIGTDMVKAIRPDVLEKIVATIPVRRLGSPDEIASIVSWLASDESGFATGADFSLN 240
300691376 161 HGFTMALAQEVATKGVTVNTVSPGYIATDMVKSIRQDVLEKIIGTIPVKRLGEPNEIASICAWLASEESGFSTGADFSLN 240
76811242  243 GGLHMG 248
113867453 241 GGLHMG 246
17546352  241 GGLHMG 246
73541043  241 GGLHMG 246
94310300  241 GGLHMG 246
187928994 241 GGLHMG 246
186475736 241 GGLHMG 246
194289469 241 GGLHMG 246
238027094 241 GGLHMG 246
300691376 241 GGLHMG 246
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap