Conserved Protein Domain Family
PRK12937

?
PRK12937: PRK12937 
short chain dehydrogenase; Provisional
Statistics
?
PSSM-Id: 171821
View PSSM: PRK12937
Aligned: 13 rows
Threshold Bit Score: 329.395
Threshold Setting Gi: 94312802
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15596667    1 MPDITQAAIVTGASRGIGRAIARRLAADGFAVAVNYASNQAMADEVVAEIVAAGGAAIAVQGDVASAEDMDKLFEATRGA 80 
116694061   5 PAISRRAALVTGASRGIGRAIALRLAADGFDVAIGYAGSAARAEETVAAAREAGSNAIAIQGDVAQAPDVARLFDTAQQA 84 
116049415   1 MPDITQAAIVTGASRGIGRAIARRLAADGFAVAVNYASNQAMADEIVAEIVAAGGAAIAVQGDVASAEDMDKLFEATRGA 80 
21240857    1 MTQQQKVALVTGASRGIGAAIAQRLAGDGFAVVLNYAGHADEADRLVRSIEADGGRAISVQADVSDPAAVARLFAAAETA 80 
78045616    1 MTQQHTVAVITGASRGIGAAIAQRLAGDGFAVVLNYAGHADEADQLVRSIEAAGGRAISVQADVSDPVAVERLFAAAETA 80 
91783115    2 AQETSKVAIVTGASRGIGASIAKRLAADGLTVVVNYSGSDAAAAAVVEQIEEASGRARSAKADISDAAAVRRMFEAAETA 81 
73537321    3 TTLSGKIAFVTGGARGIGASVVRRLAREGAAVAFTYQSSGAGAHALAEEIHAAGGRALAFQADAADAASVTRAVDDAARQ 82 
16264223    1 -METNKVAIVTGASRGIGAAIAARLASDGFTVVINYAGKAAAAEEVAGKIEAAGGKALTAQADVSDPAAVRRLFATAEEA 79 
152983994   1 MPDIIQAAVVTGASRGIGRAIARRLAADGFAVAVNYAGNQAKADEVVAEIVAAGGAAIAVQGDVASPEDMDKLFEATRGA 80 
94312802   12 AALSNKVAFVTGGSRGIGAAVVRRLAREGAAVAFTYQSSGAVAQALAESIQAAGGRARAYHADAADAAAVTRAIDAAAAD 91 
218892657   1 MPDITQAAIVTGASRGIGRAIARRLAADGFAVAVNYAGNQTMADEVVAEIVAAGGTAIAVQGDVASPEDMDKLFEATRGA 80 
226942809   1 MQTVNKAAIVTGASRGIGRAIAKRLAQDGFSVAVNYLGNQALAESVVAEIVAAGGQAIAVRGDVAEPADMAHLFARVRAT 80 
239817991   9 PVLAGKVAFVTGGSRGIGAAIVRRLAEDGAAVAFSYASSSAPADELVRSLEAEGGRALALKIDSADAAALTAGIDEAARK 88 
15596667   81 FGRIDVVVNSAGTMPYLKIADGDLEGFDRVIRTNLRGAFIVLGLAARHVERGGRIIAL-STSVIARALPSYGPYIASKSG 159
116694061  85 FGRLDVVVNSAGIMQMASVAPASLDAFDQTIATNLRGAFLVLGEAAARLGQGGRIIAL-STSVIARSLPGYGPYIAAKAG 163
116049415  81 FGRIDVVVNSAGTMPYLKIADGDLEGFDRVIRTNLRGAFIVLGLAARHVERGGRIIAL-STSVIARALPSYGPYIASKSG 159
21240857   81 FGGVDVLVNNAGIMQLATLADSDDALFDKHIAINLKGTFNTLRQAARRLRNGGRIVNL-STSVVGLKLETYGVYAATKAA 159
78045616   81 FGGVDVLVNNAGIMQLATLADSDDALFDKHIAINLKGTFNTLRQAARRLRDGGRIVNL-STSVVGLKLETYGVYAATKAA 159
91783115   82 YGGVDVLVNNAGIIGLKPIASMDDETFDRIVKVNLKGTFNTLREAANRLRPGGRIVNF-STSVVGLYQPTYAIYAATKAG 160
73537321   83 FGKIDILVNSAGVLLLGPVDDFSLEDFDKTLAVNVRGVFVAAKAALPHMGDGGRIINIgSVNADRIPFAGGSAYAMSKAA 162
16264223   80 FGGVDVLVNNAGIMPLTTIAETGDAVFDRVIAVNLKGTFNTLREAAQRLRVGGRIINM-STSQVGLLHPSYGIYAAAKAG 158
152983994  81 FGRIDVVVNSAGVMPYLKIADGDLEGFDRVIRTNLRGAFIVLGLAARHVERGGRIIAL-STSVIARALPSYGPYIASKSA 159
94312802   92 FGKIDILVNNAGVLFLGPVDTFPLEDFDKTLAVNVRAVFVAAKAALAHMGQGGRIINIgSTNADRMPFPGGAAYAMSKSA 171
218892657  81 FGRIDVVVNSAGTMPYLKIADGDLEGFDRVIRTNLRGAFIVLGLAARHVERGGRIIAL-STSVIARALPSYGPYIASKSG 159
226942809  81 YKRIDVLVNSAGVMSCLKIADGDIEPFDRMLRTNLRGAFVVLAEAARQMDQGGRIIAL-STSAIAKSFPGYGPYIASKAG 159
239817991  89 LGRIDVLVNNAGVFLPGTIDDFSLEDFDRTLDINVRAVFVAAKAAVRHMGEGGRIINIgSTNAERMPWPGGSAYAMSKSA 168
15596667  160 VEGLVHVLANELRGQDIRVNAVAPGPVATELFFNGKSAEQIDQIARLAPLERLGEPDEIAAAVSFLAGPDGAWVNSQVLR 239
116694061 164 VEGLVRVLANELRGRGITANAVAPGPVATELFLDGKSEEQVAQLSKVAPLERLGTPEDIAAAVSFLAGPDGAWINAQVVR 243
116049415 160 VEGLVHVLANELRGQDIRVNAVAPGPVATELFFNGKSAEQIDQIARLAPLERLGEPDEIAAAVSFLAGPDGAWVNSQVLR 239
21240857  160 VETLTAILSKELRGRAITVNAVAPGPTGTALFLDGKSPELIERLSKANPLERLGCPDDIAAAVAFLVGPDGGWINGQVLR 239
78045616  160 VETLTAILSKELRGRAITVNAVAPGPTGTALFLDGKSPELIERLSKANPLERLGCPDDIAAAVAFLVGPDGGWINGQVLR 239
91783115  161 VEAMTHVLSKELRGRNITVNAVAPGPTATELFFDGKTPEVIDHLTRLAPLERLGQPEDIANAVAFLAGPDGAWINGQVLR 240
73537321  163 LKGLVQGMARDLGPRGITVNNVQPGPTNTDM--NPEHSDFATSLHGLMALQRHARPEEIAGMVAYLAGPEAGFVTGASLN 240
16264223  159 VEAMTHVLSKELRGRDITVNAVAPGPTATDLFLEGKSDEVRDRFAKLAPLERLGTPQDIAGAVAFLAGPDGAWVNGQVLR 238
152983994 160 VEGLVHVLANELRGQDIRVNAVAPGPVATELFFDGKSAEQIDQIARLAPLERLGEPDEIAAAVSFLAGPDGAWVNSQVLR 239
94312802  172 LKGLVQGMARDLGPKGITVNNVQPGPVNTDM--NPEDSEFAASLHGLMALQRHAHPDEIASMVAYLAGPEAGFVTGASLN 249
218892657 160 VEGLVHVLANELRGQDIRVNAVAPGPVATELFFNGKSAEQIDQIARLAPLERLGEPDEIAAAVSFLAGPDGAWVNSQVLR 239
226942809 160 VEGLVHVLANELRGRGICVNAVAPGPVATELFFAGKSAGQIEQLAGLAPLERLGTPEDIASVVSFLAGPDGAWINAQILR 239
239817991 169 LKGLVQGLSRDLGPRGITVNNVQPGPVNTDM--NPVDGPNAAAMHGLMALARHARPEEIAGMVAYLASPEAAFVTGASLN 246
15596667  240 VNGGFA 245
116694061 244 VNGGFA 249
116049415 240 VNGGFA 245
21240857  240 ANGGMV 245
78045616  240 ANGGMV 245
91783115  241 ANGGII 246
73537321  241 IDGGFA 246
16264223  239 ANGGII 244
152983994 240 VNGGFA 245
94312802  250 VDGGFA 255
218892657 240 VNGGFA 245
226942809 240 ANGGFA 245
239817991 247 IDGGFA 252
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap