Conserved Protein Domain Family
PRK12936

?
PRK12936: PRK12936 
3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed
Statistics
?
PSSM-Id: 171820
View PSSM: PRK12936
Aligned: 15 rows
Threshold Bit Score: 462.848
Threshold Setting Gi: 150378146
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
86357081    1 MFDLSGRKALVTGASGGIGEEIARLLHQQGAIVGLHGTRVEKLEALAAELGERVKIFPANLSDRDEVKALGQKAEADLEG 80 
13476514    1 MFELTGRKALVTGASGGIGEAIARVLHAQGAIVGLHGTRIEKLEALAAELGDRVKLFPANLSNRDEVKALGQKAEADLEG 80 
15888435    1 MLDLTGRKALVTGATGGIGEEIARLLHKQGATVGLHGTRVEKLEALAAELGDRVKIFPANLADRAEVKALGEKAEAELEG 80 
15964895    1 MFDLSGRKALVTGASGGIGEEIARMLHAQGAVVGLHGTRVEKLETLANTLGERVQIFPANLSDRAEVKALGEKAEADLGG 80 
16262920    1 MFELTGRKALVTGASGAIGGAIARVLHAQGAIVGLHGTQIEKLETLATELGDRVKLFPANLANRDEVKALGQRAEADLEG 80 
150395969   1 MFDLSGRKALVTGASGGIGEEIARLLHAQGAVVGLHGTRVEKLEALADTLGERVHIFPANLSDRAEVKALGEKAEADLGG 80 
110634119   1 MFDLNGRKALVTGATGGIGEAIARALHKQGAIVGLHGTRVEKLEALAGELGERAKIFAANLSDRDDVKAFAERAESELEG 80 
222085442   1 MLDLTGRKALVTGASGGIGEEIARLLHKQGAIVGLHGTRVEKLEALAADLGDRVKIFPANLSNREEVKALGVKAEEELGG 80 
222148141   1 MFDLTGRKALVTGATGGIGEEIARMLHAQGAIVGLHGTRVEKLEALAADLGERVKIFPANLADRDEVKALGEKAEAELEG 80 
227821464   1 MFDLSGRKALVTGASGGIGEEIARMLHAQGAVVGLHGTRVEKLEALANTLGERVHIFPANLSDRAEVKALGEKAETELGG 80 
86357081   81 VDILVNNAGITKDGLFVRMSDEDWDAVLEVNLTATFRLTRELTHPMMRRRYGRIINITSVVGVTGNPGQANYCASKAGMI 160
13476514   81 VDILVNNAGITKDGLFVRMSDADWDSVIEVNLTAVFRLTRELTHPMMRRRHGRIINITSVVGVTGNPGQTNYCASKAGMI 160
15888435   81 VDILVNNAGITKDGLFVRMSDEDWDNVIEVNLTAMFRLTRELTHPMMRRRFGRIINITSIVGVTGNPGQANYCASKAGMI 160
15964895   81 VDILVNNAGITKDGLFVRMSDEDWDNVIEVNLTAVFRLTRELTHPMMRRRFGRIVNITSVVGVTGNPGQANYCASKAGMI 160
16262920   81 VDILVNNAGITKDGLFLHMADPDWDIVLEVNLTAMFRLTREITQQMIRRRNGRIINVTSVAGAIGNPGQTNYCASKAGMI 160
150395969  81 VDILVNNAGITKDGLFVRMSDEDWDNVIEVNLTAVFRLTRELTHPMMRRRFGRIVNITSIVGVTGNPGQANYCASKAGMI 160
110634119  81 IDILVNNAGITRDGLFVRMSDEDWDAVIETNLTAAFRLTRALTHPMMRRRWGRIINISSVVGVAGNPGQANYCASKAGLI 160
222085442  81 VDILVNNAGITKDGLFVRMSDEDWDSVLEVDLTSVFLLTRELTHPMMRRRYGRIINITSVVGVVGNPGQANYCAAKAGMV 160
222148141  81 VDILVNNAGITKDGLFVRMSDADWDSVLEVNLTSTFRLTRELTHPMMRRRYGRIINITSIVGVTGNPGQANYCASKAGMI 160
227821464  81 VDILVNNAGITKDGLFVRMSDEDWDNVLEVNLTAVFRLTRELTHPMMRRRFGRIVNITSVVGVTGNPGQANYCASKAGMI 160
86357081  161 GFTKSLAQEIATRNVTVNCVAPGFIESAMTGKLNDKQKEAIMGAIPMKRMGTGGEVASAVAYLASSEAAYMTGQTLHVNG 240
13476514  161 GFSKSLAQEIATRNITVNCVAPGFIESAMTDKLNDKQKEAIMAAIPTRRMGTGAEVASAVAYLASNEAAYVTGQTVHVNG 240
15888435  161 GFSKSLAQEIATRNVTVNCVAPGFIESAMTGKLNDKQKDAIMGAIPMKRMGTGAEVASAVLYLASNEAAYMTGQTLHVNG 240
15964895  161 GFSKSLAQEIATRNVTVNCVAPGFIESAMTGKLNDKQKEGIMSAIPMRRMGSGAEVASAVAYLASNEAGYVTGQTIHVNG 240
16262920  161 GFSKSLAQEIATRNITVNCVAPGFIESAMTDKLNHKQKEKIMVAIPIHRMGTGTEVASAVAYLASDHAAYVTGQTIHVNG 240
150395969 161 GFSKSLAQEIATRNVTVNCVAPGFIESAMTGKLNDKQKEGIMSAIPMRRMGNGAEVASAVAYLASNEAGYVTGQTIHVNG 240
110634119 161 GFSKSLAQEVASRNITVNCVAPGFIETAMTDKLNEKQRESIMGAIPMRRMGSGEEIATAVVYLASEEAAYVTGQTIHVNG 240
222085442 161 GFTKSLAQEIATRNVTVNCVAPGFIESAMTGKLNDKQKEAIMGAIPMKRMGNGAEVASAVAYLASSEASYVTGQTIHVNG 240
222148141 161 GFSKSLAQEIAARNVTVNCIAPGFIESAMTGKLNDKQKDTIMGAIPMKRMGTGAEIASAVLYLASSEASYVTGQTLHVNG 240
227821464 161 GFSKSLAQEIATRNVTVNCVAPGFIESAMTGKLNDKQKEGIMAAIPMRRMGSGAEVASAVAYLASNEAAYVTGQTIHVNG 240
86357081  241 GMAMI 245
13476514  241 GMAMI 245
15888435  241 GMAMI 245
15964895  241 GMAMI 245
16262920  241 GMAMI 245
150395969 241 GMAMI 245
110634119 241 GMLMV 245
222085442 241 GMAMI 245
222148141 241 GMAMI 245
227821464 241 GMAMI 245
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap