Conserved Protein Domain Family
PRK12911

?
PRK12911: PRK12911 
bifunctional preprotein translocase subunit SecD/SecF; Reviewed
Statistics
?
PSSM-Id: 171815
View PSSM: PRK12911
Aligned: 13 rows
Threshold Bit Score: 2685.01
Threshold Setting Gi: 15836095
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
29839945     1 MKQRFGRNLSIIVFVFGLALYYVLPTCLYYSRPLSKKIDEKEAQQIVRKLTNQVSEVRSDIIPRVSSVLSALKLRGHIAQ 80  
15835348     1 MKRNFKRNLSVIIFVFALALYHVLPTCLYYSRPLNKKIEGREAHKIIERLTQQVADARNDLTVRVKRILSTLKLRGSVKP 80  
15836095     1 MKQKVKRNFAIIICVFALALYYVLPTCLYYAKPLDKKIDGNEAEHIIKSFTKQAQQVRKDVIPRVSAILSSLHLRGHIQQ 80  
15605175     1 MKRNFKRNLSIIILVFALALYHVLPTCLYYSRPLNRKIDGREARKIIERFTRQVSDARNDLTLRVAKILSTLKLRGDIKQ 80  
15618475     1 MKQKVKRNFAIIICVFALALYYVLPTCLYYAKPLDKKIDGNEAEHIIKSFTKQAQQVRKDVIPRVSAILSSLHLRGHIQQ 80  
33241917     1 MKQKVKRNFAIIICVFALALYYVLPTCLYYAKPLDKKIDGNEAEHIIKSFTKQAQQVRKDVIPRVSAILSSLHLRGHIQQ 80  
16752475     1 MKQKVKRNFAIIICVFALALYYVLPTCLYYAKPLDKKIDGNEAEHIIKSFTKQAQQVRKDVIPRVSAILSSLHLRGHIQQ 80  
89898635     1 MKQRFGRNLSIIICVFGLALYYVLPTCLYYSRPLNKKIDEKEAQQIVRRLTKQVAEARSDIIPRVSSVLSALKLRGHITQ 80  
62184819     1 MKQRFGRNLSIIICVFGLALYYVLPTCLYYSRPLNKKVDEKEAQQIVRKLTNQVAEVRSDIIPRVSSVLSALKLRGHIVQ 80  
166155537    1 MKRNFKRNLSIIILVFALALYHVLPTCLYYSRPLNRKIDGREARKIIERFTRQVSDARNDLTLRVAKILSTLKLRGDIKQ 80  
166154662    1 MKRNFKRNLSIIILVFALALYHVLPTCLYYSRPLNRKIDGREARKIIERFTRQVSDARNDLTLRVAKILSTLKLRGDIKQ 80  
237802876    1 MKRNFKRNLSIIILVFALALYHVLPTCLYYSRPLNRKIDGREARKIIERFTRQVSDARNDLTLRVAKILSTLKLRGDIKQ 80  
237804798    1 MKRNFKRNLSIIILVFALALYHVLPTCLYYSRPLNRKIDGREARKIIERFTRQVSDARNDLTLRVAKILSTLKLRGDIKQ 80  
29839945    81 HPSIPGVVNIHFKDHADAYTFLENMIYGEPTVPIKSSRLYVLGYERKEGS-VVQVTGSLTTALTEKDFSFVSY--NREDA 157 
15835348    81 HLSIPGVVNVHFPLAEDAAVFIDNVVHGEHSVPTKSARLYVLGSSELTGEtIVQVSGSLVTSLTEEDFSFVSY--EDKDL 158 
15836095    81 HPAIPDIVSVRFKRGEDAEDFIGNLVHGEPNVPIKSARLHVVGYSREHDDhVIQVASSINTSLVESDFSFVSYssENEQE 160 
15605175    81 HPSIPGVVNVHFPLAEDAALFIDNVVHGEPSVPVKSARLYVVGSSEFTGEtVVQISGSLVTSLTEKDLSFVSY--EDKDV 158 
15618475    81 HPAIPDIVSVRFKRGEDAEDFIGNLVHGEPNVPIKSARLHVVGYSREHDDhVIQVASSINTSLVESDFSFVSYssENEQE 160 
33241917    81 HPAIPDIVSVRFKRGEDAEDFIGNLVHGEPNVPIKSARLHVVGYSREHDDhVIQVASSINTSLVESDFSFVSYssENEQE 160 
16752475    81 HPAIPDIVSVRFKRGEDAEDFIGNLVHGEPNVPIKSARLHVVGYSREHDDhVIQVASSINTSLVESDFSFVSYssENEQE 160 
89898635    81 HPSIPGVVNVHFKDRADAYTFLENMVYGEPTVPIKSSRLYVLGYDKKDGN-VVQVTGSLTTALTEKDFSFVSY--NREDT 157 
62184819    81 HPSIPGVVNIHFKDNADAYTFLENMIYGEPTVPIKSSRLYVLGYDNKDGG-VVQVTGTLTTALTENDFSFVSY--NREDA 157 
166155537   81 HPSIPGVVNVHFPLAEDAALFIDNVVHGEPSVPVKSARLYVVGSSEFTGEtVVQISGSLVTSLTEEDLSFVSY--EDKDV 158 
166154662   81 HPSIPGVVNVHFPLAEDAALFIDNVVHGEPSVPVKSARLYVVGSSEFTGEtVVQISGSLVTSLTEEDLSFVSY--EDKDV 158 
237802876   81 HPSIPGVVNVHFPLAEDAALFIDNVVHGEPSVPVKSARLYVVGSSEFTGEtVVQISGSLVTSLTEKDLSFVSY--EDKDI 158 
237804798   81 HPSIPGVVNVHFPLAEDAALFIDNVVHGEPSVPVKSARLYVVGSSEFTGEtVVQISGSLVTSLTEKDLSFVSY--EDKDI 158 
29839945   158 ESGTEILNIAASSITpNPSGACSCGYPSFWATASIDRVVQLAKNLSLGLDILPNFRTASLLNYFFSSERDYSAFLARLES 237 
15835348   159 VVSQELENIATNLFV-NVECSCDHGYSSLWDSMPIEKVAHIARGICSGLRLLPTEKTQAFLSRFLGTEQDFVAFLSRVEN 237 
15836095   161 MASSILQRVYSACTF-PKQKDCSCSYPSIWETAPKEQLLQYAKNLSSGFEVFSSRLS-AFCQQSFSSNQDRLAFLSRLSS 238 
15605175   159 TVSQELENLATNLFI-ESERPCECGYYSLWDSMPIEKVIYVTRNICSGLRLLPARKTQAFLSRCLGTERDFTAFLARLEK 237 
15618475   161 MASSILQRVYSACTF-PKQKDCSCSYPSIWETAPKEQLLQYAKNLSSGFEVFSSRLS-AFCQQSFSSNQDRLAFLSRLSS 238 
33241917   161 MASSILQRVYSACTF-PKQKDCSCSYPSIWETAPKEQLLQYAKNLSSGFEVFSSRLS-AFCQQSFSSNQDRLAFLSRLSS 238 
16752475   161 MASSILQRVYSACTF-PKQKDCSCSYPSIWETAPKEQLLQYAKNLSSGFEVFSSRLS-AFCQQSFSSNQDRLAFLSRLSS 238 
89898635   158 ESGREILNTAAALITlAPSGACSCGYTSIWNTASIEKVVQLANNLASGLDIFPASKTSALLNYFFSSEKDYSAFLTRLEN 237 
62184819   158 EPAKEMLNAALYLLTsAPAHACSCGYTSIWNTASIARVVQLAENLAVGLDILPHSRTVALLNYFFSSEKDYSAFLSRLEN 237 
166155537  159 TVSQELENLATNLFI-ESERPCECGYYSLWDSMPIEKVIHVTRNICSGLRLLPTRKTQVFLSRCLGTERDFTAFLARLEK 237 
166154662  159 TVSQELENLATNLFI-ESERPCECGYYSLWDSMPIEKVIHVTRNICSGLRLLPTRKTQVFLSRCLGTERDFTAFLARLEK 237 
237802876  159 TVSQELENLATNLFI-ESERPCECGYYSLWDSMPIEKVIHVTRNICSGLRLLPARKTQAFLSRCLGTERDFTAFLARLEK 237 
237804798  159 TVSQELENLATNLFI-ESERPCECGYYSLWDSMPIEKVIHVTRNICSGLRLLPARKTQAFLSRCLGTERDFTAFLARLEK 237 
29839945   238 LSMDSNISEQHQSIFRDLChDLKTRAQRWKKTTTRIVDNSLECSAVSPFFSSVEFLSkERKLVFCLDPHVLAKREELPIE 317 
15835348   238 ALHHEDVKEYREELNEAAY-LLHSRNLRWNEMSPRVVGNVVDCSELSPCFSSMSLTG-DGKLLFHFDADVIAKRQQLVGD 315 
15836095   239 LSNDAAIDVEDQKLLKSVYeTLSQTACIRSLDCPYIEGLRLDCSESSLFFSSIEYCPkERKIFLTLHSDLLAQRTSLSKE 318 
15605175   238 ALQHEEVKEAREELKDASY-LLHSRNLRWNSISPKVVGNVVDCSELSPCFSSMSLTA-DGKLLFHFDAEVAANRQQLVGN 315 
15618475   239 LSNDAAIDVEDQKLLKSVYeTLSQTACIRSLDCPYIEGLRLDCSESSLFFSSIEYCPkERKIFLTLHSDLLAQRTSLSKE 318 
33241917   239 LSNDAAIDVEDQKLLKSVYeTLSQTACIRSLDCPYIEGLRLDCSESSLFFSSIEYCPkERKIFLTLHSDLLAQRTSLSKE 318 
16752475   239 LSNDAAIDVEDQKLLKSVYeTLSQTACIRSLDCPYIEGLRLDCSESSLFFSSIEYCPkERKIFLTLHSDLLAQRTSLSKE 318 
89898635   238 LSSDSTLSEQQQSVLRDEFqHLKARVQRWKKSTMSLVDNSLNCSAVSPFFSSIEFFAkERKLVFRLDPRVLAKRDELSAE 317 
62184819   238 VATLSDLSEQQRSVLQSVYqNLKLRAPRWKKAFTRIVDNSLDCSALSPFFSSVDFSPkERKLVFCLDPHVVAKRDELSAE 317 
166155537  238 ALQHEEVKEAREELKDASY-LLHSRNLRWNSISPKVVGNVVDCSELSPCFSSMSLTA-DGKLLFHFDAEVAANRQQLVGN 315 
166154662  238 ALQHEEVKEAREELKDASY-LLHSRNLRWNSISPKVVGNVVDCSELSPCFSSMSLTA-DGKLLFHFDAEVAANRQQLVGN 315 
237802876  238 ALQHEEVKEAREELKDASY-LLHSRNSRWNSISPKVVGNVVDCSELSPCFSSMSLTA-DGKLLFHFDAEVAANRQQLVGN 315 
237804798  238 ALQHEEVKEAREELKDASY-LLHSRNSRWNSISPKVVGNVVDCSELSPCFSSMSLTA-DGKLLFHFDAEVAANRQQLVGN 315 
29839945   318 QRLDFDAWLAKEKHRLAHKFQRPLQETSQGFSLNLSDKDASGKIVLHGQRIYQGMVEHLATLALNRPPAESCDLVRENFP 397 
15835348   316 ERLDLERLFAVEKQHIATRLNRSVEETESGFAFRLRDEAASGKIVLQGHRVCQRIVEHLTALVLNRPIAETCDLSIENFP 395 
15836095   319 QRLDFDSRLAVEKQKLSKNLTVQVEDYNNGFSFQWMDKDTQGKIILQGERLLQGIAEHLTALTLHRPAAESCDLIPENFP 398 
15605175   316 ERLDLERLFAMEKQHIATRLNRSVEGTEFGFAVRLRDEAASGKIVLQGHRVCQRIVEHLTALVLNRPIAETCDLSTENFP 395 
15618475   319 QRLDFDSRLAVEKQKLSKNLTVQVEDYNNGFSFQWMDKDTQGKIILQGERLLQGIAEHLTALTLHRPAAESCDLIPENFP 398 
33241917   319 QRLDFDSRLAVEKQKLSKNLTVQVEDYNNGFSFQWMDKDTQGKIILQGERLLQGIAEHLTALTLHRPAAESCDLIPENFP 398 
16752475   319 QRLDFDSRLAVEKQKLSKNLTVQVEDYNNGFSFQWMDKDTQGKIILQGERLLQGIAEHLTALTLHRPAAESCDLIPENFP 398 
89898635   318 QRLDFDSWLGREKQRLAHRLQKSAQESSQEFAFNLSDKDTSGKIVLHGQRIYQGTVEHLATLALNRPPAQSCDLIREHFP 397 
62184819   318 QRLDFDSWLAKEKQRLARKLQQPAQESVQGFVFNLSDKEASGKIVLHGQRIYQGIVEHLATLALHRPPAQSCDLIRENFP 397 
166155537  316 ERLDLERLFAMEKQHIATRLNRSVEETEFGFAVRLRDEAASGKIVLQGHRVCQRIVEHLTALVLNRPLAETCDLSTENFP 395 
166154662  316 ERLDLERLFAMEKQHIATRLNRSVEETEFGFAVRLRDEAASGKIVLQGHRVCQRIVEHLTALVLNRPLAETCDLSTENFP 395 
237802876  316 ERLDLERLFAMEKQHIATRLNRSVEGTEFGFAVRLRDEAASGKIVLQGHRVCQRIVKHLTALVLNRPIAETCDLSTENFP 395 
237804798  316 ERLDLERLFAMEKQHIATRLNRSVEGTEFGFAVRLRDEAASGKIVLQGHRVCQRIVEHLTALVLNRPIAETCDLSTENFP 395 
29839945   398 IHCRLPRESDTFGCFIFSPEKSCSHFSKGSVYIVLKGLRSVAAKYEKGNAEEAKVFDKDLQNLYNCFAYTDAAPWSIGED 477 
15835348   396 VYSREPMENDTLGCFIFSPDSSCRHFSKGSVYIVFKGLRSIIAKCESSGPQEAGLLQQDLQNLYACFIHTDAVSWSLGED 475 
15836095   399 VFCRQPRESEAFGCYIFSPNTDCKHFSKGSVYILLKGLRSIVAKYQQGGGKELQSFEKDLQNLYNCFSHTEAISWTLGED 478 
15605175   396 VYGREPLDSDALGCFIFSPERSCRHFSKGSVYIVFKGLRSIVAKYEHAGAEEAALLQHDLQNLYACFIHTDAVSWSLGED 475 
15618475   399 VFCRQPRESEAFGCYIFSPNTDCKHFSKGSVYILLKGLRSIVAKYQQGGGKELQSFEKDLQNLYNCFSHTEAISWTLGED 478 
33241917   399 VFCRQPRESEAFGCYIFSPNTDCKHFSKGSVYILLKGLRSIVAKYQQGGGKELQSFEKDLQNLYNCFSHTEAISWTLGED 478 
16752475   399 VFCRQPRESEAFGCYIFSPNTDCKHFSKGSVYILLKGLRSIVAKYQQGGGKELQSFEKDLQNLYNCFSHTEAISWTLGED 478 
89898635   398 IYCRLPKESDSFGCFIFSPEKSCAHFSQGSVYVVLKGLRSVAAKYEKGTEEEAKIFDQDLQNLYNCFAHTDVTPWSIGDD 477 
62184819   398 IHCRLPKESDAYGCFIFSPEKSCSHFSKGSIYVVLKGLRSVAAKYEQGAEEDAKIFDKDLHNLYNCFAHTDVTPWSLGED 477 
166155537  396 VYGRELLDSDALGCFIFSPERSCRHFSKGSVYIVFKGLRSIVAKYEHAGAEEAALLQHDLQNLYACFIHTDAVSWSLGED 475 
166154662  396 VYGREPLDSDALGCFIFSPERSCRHFSKGSVYIVFKGLRSIVAKYEHAGAEEAALLQHDLQNLYACFIHTDAVSWSLGED 475 
237802876  396 VYGREPLDSDTLGCFIFSPERSCRHFSKGSVYIVFKGLRSIVAKYEHAGAEEAALLQHDLQNLYACFIHTDAVSCSLGED 475 
237804798  396 VYGREPLDSDTLGCFIFSPERSCRHFSKGSVYIVFKGLRSIVAKYEHAGAEEAALLQHDLQNLYACFIHTDAVSCSLGED 475 
29839945   478 EVLEVKEPLQRFFDVWGENFVVSNegEIASLEVRDIRDRLETLNRIEKHRQEEWVRWHEQYQQASCSMDDQQRVRAAVPH 557 
15835348   476 RVLEIKEPLQRVIQVWGEEFVQSF--GEASLEVRDVRDRLAVVNRIEKAQHAELVRWDDQYRQAQCSMNPQVRLRAAIPH 553 
15836095   479 QVLEIRHPLQQFLDVWGEGFVIGKe-GCAFLEVKDIQDRLATVNQIEKNRQSDLVRWHEQYRHAKCSMDLQERLSAPIPY 557 
15605175   476 RVLEIKEPLQRVIRIWGEEFVQSF--GKASLEVRDVRDRLAVVNRIEKTQHAELVRWDEQYRQAQCSMNPRVRLRAAIPH 553 
15618475   479 QVLEIRHPLQQFLDVWGEGFVIGKe-GCAFLEVKDIQDRLATVNQIEKNRQSDLVRWHEQYRHAKCSMDLQERLSAPIPY 557 
33241917   479 QVLEIRHPLQQFLDVWGEGFVIGKe-GCAFLEVKDIQDRLATVNQIEKNRQSDLVRWHEQYRHAKCSMDLQERLSAPIPY 557 
16752475   479 QVLEIRHPLQQFLDVWGEGFVIGKe-GCAFLEVKDIQDRLATVNQIEKNRQSDLVRWHEQYRHAKCSMDLQERLSAPIPY 557 
89898635   478 EVLEIKEPLQRFFDVWGENFVVDSegKTASLEVRDVRDRLETLNCIEKHRQEELVRWHEQYRQSSCSIDPQLRIRAAVPH 557 
62184819   478 EVLEIRQPLQRYFDVWGENFVVANegATASLEVRDIRDRLETLNRIEKRRQEEWVRWHEQYRQSSCSMDPQQRIRAAVPH 557 
166155537  476 RVLEIKEPLQRVIRIWGEEFVQSF--GKASLEVRDVRDRLAVVNRIEKTQHAELVRWDEQYRQAQCSMNPQVRLRAAIPH 553 
166154662  476 RVLEIKEPLQRVIRIWGEEFVQSF--GKASLEVRDVRDRLAVVNRIEKTQHAELVRWDEQYRQAQCSMNPQVRLRAAIPH 553 
237802876  476 RVLEIKEPLQRVIRIWGEEFVQSF--GKASLEVRDVRDRLAVVNRIEKTQHAELVRWDEQYRQAQCSMNPQVRLRAAIPH 553 
237804798  476 RVLEIKEPLQRVIRIWGEEFVQSF--GKASLEVRDVRDRLAVVNRIEKTQHAELVRWDEQYRQAQCSMNPQVRLRAAIPH 553 
29839945   558 RSAFVENLKLNLRKYSRGDNVLRFGIDFIGGKQIRLAFKDHQGKQLTDKEGILKVSDELYARLNKLGVAEVEIRREGDNV 637 
15835348   554 KNVFVENFKLNVRKYSRGEHVLRFGTDFVGGKQIRLAFRDHQGNLVTDKEGIDKVSDELYARLNKLGVSEVGMQREGDHI 633 
15836095   558 QNLFLENMKLNMRKFSRGENILRLGIDFVGGRQLLLSFKDHQGKQLTDKEDILKVSDELCARLNKLGVSEIELRREGDYI 637 
15605175   554 KNIFFENLKLNIRKYSRGEHVLRFGTDFVGGKQIRIAFRDHQGNLLTDKAGIDKVSDELYARLNKLGVSEVGMQREGDHI 633 
15618475   558 QNLFLENMKLNMRKFSRGENILRLGIDFVGGRQLLLSFKDHQGKQLTDKEDILKVSDELCARLNKLGVSEIELRREGDYI 637 
33241917   558 QNLFLENMKLNMRKFSRGENILRLGIDFVGGRQLLLSFKDHQGKQLTDKEDILKVSDELCARLNKLGVSEIELRREGDYI 637 
16752475   558 QNLFLENMKLNMRKFSRGENILRLGIDFVGGRQLLLSFKDHQGKQLTDKEDILKVSDELCARLNKLGVSEIELRREGDYI 637 
89898635   558 RNAFLENLKLNIRKYSRGDSVLRLGIDFIGGKQIRLAFKDHQGKPIADKEDILKVSDELYARLNKLGVAEVEIRREGDNV 637 
62184819   558 RSAFVENLKLNLRKYSRGDSVLRLGIDFIGGKQIRLAFKDHQGKQLTDKEGILKVSDELYARLNRLGVSEVEIRREGDNV 637 
166155537  554 KNVFFENLKLNIRKYSRGEHVLRFGTDFVGGKQIRIAFRDHQGNLLTDKAGIDKVSDELYARLNKLGVSEVGMQREGDHI 633 
166154662  554 KNVFFENLKLNIRKYSRGEHVLRFGTDFVGGKQIRIAFRDHQGNLLTDKAGIDKVSDELYARLNKLGVSEVGMQREGDHI 633 
237802876  554 KNIFFENLKLNIRKYSRGEHVLRFGTDFVGGKQIRIAFRDHQGNLLTDKAGIDKVSDELYARLNKLGVSEVGMQREGDHI 633 
237804798  554 KNIFFENLKLNIRKYSRGEHVLRFGTDFVGGKQIRIAFRDHQGNLLTDKAGIDKVSDELYARLNKLGVSEVGMQREGDHI 633 
29839945   638 HLSVPGSTKISSEEILGTSQMTFHVVNEKFSHYSALRYEVQRFLDYLWFTARSQETTSPEAINKLASRIFNDQSFPLPTS 717 
15835348   634 QVSVPGAANLSSADILGTSKMSFHVVNEQFSSRSPLRYEVQTFLDYLWFTARSLDKSSPKDINHLAATIFHENQGPIPAN 713 
15836095   638 HLSVPGSSTISSSEILGTSKMSFHVVNERFSSYSASRYEVQRFLDYLWFTSQAQGKTSPEEINTFASALFN-EEVDVPPS 716 
15605175   634 QVSVPGAAGISSADILGTSKMSFHVVNEQFSSRSPLRYEVQTFLDYLWFTARSLDECSPQAINRLAGALFHGDNGSAPAN 713 
15618475   638 HLSVPGSSTISSSEILGTSKMSFHVVNERFSSYSASRYEVQRFLDYLWFTSQAQGKTSPEEINTFASALFN-EEVDVPPS 716 
33241917   638 HLSVPGSSTISSSEILGTSKMSFHVVNERFSSYSASRYEVQRFLDYLWFTSQAQGKTSPEEINTFASALFN-EEVDVPPS 716 
16752475   638 HLSVPGSSTISSSEILGTSKMSFHVVNERFSSYSASRYEVQRFLDYLWFTSQAQGKTSPEEINTFASALFN-EEVDVPPS 716 
89898635   638 YLSVPGSEKISSEEILGTSQMTFHVVNEKFSYYSALRYEVQRFLDYLWFTAQSQEATSPEAINKLASYIFNNQEIRLPTS 717 
62184819   638 HLSVPGSTKISSEEILGTSQMTFHVVNEKFSPYSALRYEVQRFLDYLWFTAQSQEATSPEAVNKLASDIFNNPDSRLPSS 717 
166155537  634 QVSVPGAAGISSADILGTSKMSFHVVNEQFSSRSPLRYEVQTFLDYLWFTARSLDECSPQAINRLAGALFHGDNGSAPAN 713 
166154662  634 QVSVPGAAGISSADILGTSKMSFHVVNEQFSSRSPLRYEVQTFLDYLWFTARSLDECSPQAINRLAGALFHGDNGSAPAN 713 
237802876  634 QVSVPGVAGISSADILGTSKMSFHVVNEQFSSRSPLRYEVQTFLDYLWFTARSLDECSPQAINRLAGALFHGDNGSAPAN 713 
237804798  634 QVSVPGVAGISSADILGTSKMSFHVVNEQFSSRSPLRYEVQTFLDYLWFTARSLDECSPQAINRLAGALFHGDNGSAPAN 713 
29839945   718 VKEAVAKLQQEGLAFPEvGGEAASSHLDTTYSMIAIEKNIEGRANPLMIVFRNYALDGASLKNIRPEFAVGEGYILNFSV 797 
15835348   714 VRAAIGKLKEAGLNFSK-EHEMGSACLDTQYSMIAVEKGSGEQVNPLMIVFRNHALEGASLKNIRPEFAVGEGYVLNFGV 792 
15836095   717 VHEAITKLKSEGLAFSPsGCETPSTDLDTTFSMIAIGKDAEQKANPLVIVFRNYALDGASLKDIRPEFAAGEGYVLNFSV 796 
15605175   714 VRVAVEKLREAGLSFSK-ELEGGSASLDTQYSMIAIEKESREQVNPLMIVFRNHALEGASLKNIRPEFAVGEGYVLNFGV 792 
15618475   717 VHEAITKLKSEGLAFSPsGCETPSTDLDTTFSMIAIGKDAEQKANPLVIVFRNYALDGASLKDIRPEFAAGEGYVLNFSV 796 
33241917   717 VHEAITKLKSEGLAFSPsGCETPSTDLDTTFSMIAIGKDAEQKANPLVIVFRNYALDGASLKDIRPEFAAGEGYVLNFSV 796 
16752475   717 VHEAITKLKSEGLAFSPsGCETPSTDLDTTFSMIAIGKDAEQKANPLVIVFRNYALDGASLKDIRPEFAAGEGYVLNFSV 796 
89898635   718 VRDAITKLQQEGLAFPEvGSDAPSSHLDTTYSMIAIKKDREDKANPLMIVFRNYALDGASLKNIRPEFAISEGYILNFSV 797 
62184819   718 VQEAVAKLQQEGLAFPKmDNEIASSHLDTTYSMIAIEKDVEGKANPLMIVFRNYALDGASLKNIRPEFAVGEGYILNFSV 797 
166155537  714 VRVAVEKLREAGLSFSK-ELEGGSASLDTQYSMIAIEKESREQVNPLMIVFRNHALEGASLKNIRPEFAVGEGYVLNFGV 792 
166154662  714 VRVAVEKLREAGLSFSK-ELEGGSASLDTQYSMIAIEKESREQVNPLMIVFRNHALEGASLKNIRPEFAVGEGYVLNFGV 792 
237802876  714 VRVAVEKLREAGLSFSK-ELEGGSASLDTQYSMIAIEKESREQVNPLMIVFRNHALEGASLKNIRPEFAVGEGYVLNFGV 792 
237804798  714 VRVAVEKLREAGLSFSK-ELEGGSASLDTQYSMIAIEKESREQVNPLMIVFRNHALEGASLKNIRPEFAVGEGYVLNFGV 792 
29839945   798 KDTAIAQRAHNiSPTESFHAWTAAYCQEGVSGTTNSQHSSGRGWRMAVVLDGYVVSDPVLNAPLKDHASVSGKFSHREVN 877 
15835348   793 KDKAVSLDSKE-TPVQQFHAWTSKFCQEGVNGTKNSQFSGGRGWRMAVVLDGYVISDPVLNVPLKDHASVSGNFSYREVN 871 
15836095   797 KDTSPKKMAEKlSPTESFHTWTSAYCQEGISGTANGQYSANRGWRMAVVIDGYMVSSPILNVPLKNHASVSGKFTHREVS 876 
15605175   793 KDKATFSDGRE-TPVQQFHAWTSKFCQEGVSGTKNGLFSGGRGWRMAVVLDGYVISDPVLNVPLKDHASVSGNFSYREVH 871 
15618475   797 KDTSPKKMAEKlSPTESFHTWTSAYCQEGISGTANGQYSANRGWRMAVVIDGYMVSSPILNVPLKNHASVSGKFTHREVS 876 
33241917   797 KDTSPKKMAEKlSPTESFHTWTSAYCQEGISGTANGQYSANRGWRMAVVIDGYMVSSPILNVPLKNHASVSGKFTHREVS 876 
16752475   797 KDTSPKKMAEKlSPTESFHTWTSAYCQEGISGTANGQYSANRGWRMAVVIDGYMVSSPILNVPLKNHASVSGKFTHREVS 876 
89898635   798 KDSTIAQKAHNvSPTESFHAWTAAYCQEGINGTTNSQYSSGRGWRMAVVLDGYVVSDPVLNAPLKDHASVSGKFSHREVN 877 
62184819   798 KDTGIAQKAHDvSPRESFHAWTSTYCQEGINGTANGQHSSGRGWRMAVVLDGYVVSDPVLNAPLKDQASVSGKFSHREVH 877 
166155537  793 KDKATFSDGRE-TPVQQFHAWTSKFCQEGVSGTKNGLFSGGRGWRMAVVLDGYVISDPVLNVPLKDHASVSGNFSYREVH 871 
166154662  793 KDKATFSDGRE-TPVQQFHAWTSKFCQEGVSGTKNGLFSGGRGWRMAVVLDGYVISDPVLNVPLKDHASVSGNFSYREVH 871 
237802876  793 KDKATFSDGRE-TPVQQFHAWTSKFCQEGVSGTKNGLFSGGRGWRMAVVLDGYVISDPVLNVPLKDHASVSGNFSYREVH 871 
237804798  793 KDKATFSDGRE-TPVQQFHAWTSKFCQEGVSGTKNGLFSGGRGWRMAVVLDGYVISDPVLNVPLKDHASVSGNFSYREVH 871 
29839945   878 RLATDLKSGSMSFVPEVLSEEVISPELGKQQRTQGIISICLGLAVLIILMSVYYKFGGVIASGAVILNLLLIWAALQYLD 957 
15835348   872 RLASDLKSGAMSFIPEILSEEVVSPELGHSQRLQGILSVFLGLVVLIALMSVYYKFGGVIASVAVLLNLLLIWASMQYLD 951 
15836095   877 KLASDLKSGAMSFVPEVLSEETISSDLGKKQCTQGIISACCGLAMLIVLMSVYYRFGGVIASGAVLLNLLLIWAALQYLD 956 
15605175   872 RLAADLKSGAMSFIPEILSEEVVSPELGSSQRVQGILSVVLGLVVLIVLMSVYYRFGGVIASIAVLLNLLLIWASMQYLD 951 
15618475   877 KLASDLKSGAMSFVPEVLSEETISSDLGKKQCTQGIISACCGLAMLIVLMSVYYRFGGVIASGAVLLNLLLIWAALQYLD 956 
33241917   877 KLASDLKSGAMSFVPEVLSEETISSDLGKKQCTQGIISACCGLAMLIVLMSVYYRFGGVIASGAVLLNLLLIWAALQYLD 956 
16752475   877 KLASDLKSGAMSFVPEVLSEETISSDLGKKQCTQGIISACCGLAMLIVLMSVYYRFGGVIASGAVLLNLLLIWAALQYLD 956 
89898635   878 RLATDLKSGSMSFVPEVLIEEVISPELGKQQRTQGIISILLGLAVLIILMSVYYKFGGVIASGAVILNLLLIWAALQYLD 957 
62184819   878 RLATDLKSGSMSFVPEVLSEEVISPELGKQQRTQGIISVCLGLAVLIILMSVYYKFGGVIASGAVILNLLLIWAALQYLD 957 
166155537  872 RLATDLKSGAMSFIPEILSEEVVSPELGSSQRVQGILSVVLGLVVLIVLMSVYYRFGGVIASIAVLLNLLLIWASMQYLD 951 
166154662  872 RLATDLKSGAMSFIPEILSEEVVSPELGSSQRVQGILSVVLGLVVLIVLMSVYYRFGGVIASIAVLLNLLLIWASMQYLD 951 
237802876  872 RLAADLKSGAMSFIPEILSEEVVSPELGSSQRVQGILSVVLGLVVLIVLMSVYYRFGGVIASIAVLLNLLLIWASMQYLD 951 
237804798  872 RLAADLKSGAMSFIPEILSEEVVSPELGSSQRVQGILSVVLGLVVLIVLMSVYYRFGGVIASIAVLLNLLLIWASMQYLD 951 
29839945   958 APLTLTGLAGIVLAMGMAVDANVLVFERIREEYLLSRSLTQSVEAGYKKAFSAIFDSNLTTILASLLLLVLDTGPIKGFA 1037
15835348   952 APLTLSGLAGIILAMGMAVDANVLVFERIREEYLLSRSLSESVEAGYKKAFSAIFDSNLTTILASALLLMLDTGPIKGFA 1031
15836095   957 APLTLSGLAGIVLAMGMAVDANVLVFERIREEFLLSQSLKKSVEKGYTKAFGAIFDSNLTTVLASALLFFLDTGPIKGFA 1036
15605175   952 APLTLSGLAGIILAMGMAVDANVLVFERIREEYLLTRSLSESVEAGYKKAFSAIFDSNLTTILASALLLMLDTGPIKGFA 1031
15618475   957 APLTLSGLAGIVLAMGMAVDANVLVFERIREEFLLSQSLKKSVEKGYTKAFGAIFDSNLTTVLASALLFFLDTGPIKGFA 1036
33241917   957 APLTLSGLAGIVLAMGMAVDANVLVFERIREEFLLSQSLKKSVEKGYTKAFGAIFDSNLTTVLASALLFFLDTGPIKGFA 1036
16752475   957 APLTLSGLAGIVLAMGMAVDANVLVFERIREEFLLSQSLKKSVEKGYTKAFGAIFDSNLTTVLASALLFFLDTGPIKGFA 1036
89898635   958 APLTLTGLAGIVLAMGMAVDANVLVFERIREEYVLSRSLSQSVEAGYKKAFGAIFDSNLTTVLASLLLLILDTGPIKGFA 1037
62184819   958 APLTLTGLAGIVLAMGMAVDANVLVFERIREEYLLSRSLTQSVEAGYKKAFGAIFDSNLTTVLASLLLLVLDTGPIKGFA 1037
166155537  952 APLTLSGLAGIILAMGMAVDANVLVFERIREEYLLTRSLSESVEAGYKKAFSAIFDSNLTTILASALLLMLDTGPIKGFA 1031
166154662  952 APLTLSGLAGIILAMGMAVDANVLVFERIREEYLLTRSLSESVEAGYKKAFSAIFDSNLTTILASALLLMLDTGPIKGFA 1031
237802876  952 APLTLSGLAGIILAMGMAVDANVLVFERIREEYLLTRSLSESVEAGYKKAFSAIFDSNLTTILASALLLMLDTGPIKGFA 1031
237804798  952 APLTLSGLAGIILAMGMAVDANVLVFERIREEYLLTRSLSESVEAGYKKAFSAIFDSNLTTILASALLLMLDTGPIKGFA 1031
29839945  1038 LTLILGIFSSMFTALFMTKFFFMVWMNKTQETQLHMMNKFIGIKHDFLKECKRLWMVSGSVIVLGCVALGFGAWNSVLGM 1117
15835348  1032 LTLIIGIFSSMFTSLFMTKFFFLIWIQKTRETQLHMMNKFIGVKHNFLKECKRLWVVSGAVVVLGCIGLGFGAWDSILGM 1111
15836095  1037 LTLILGIFSSMFTALFMTKFFFMLWMNKTQHTQLHMMNKFVGIKHDFLRGCKKLWAVSGSVFLLGCVALGFGAWNSVLGM 1116
15605175  1032 LTLIIGIFSSMFTALFMTKFFFVIWVQKTRETQLHMMNKFIGIKHNFLKECKRLWVVSGVVLVLGCVGLGFGAWDSVFGM 1111
15618475  1037 LTLILGIFSSMFTALFMTKFFFMLWMNKTQHTQLHMMNKFVGIKHDFLRGCKKLWAVSGSVFLLGCVALGFGAWNSVLGM 1116
33241917  1037 LTLILGIFSSMFTALFMTKFFFMLWMNKTQHTQLHMMNKFVGIKHDFLRGCKKLWAVSGSVFLLGCVALGFGAWNSVLGM 1116
16752475  1037 LTLILGIFSSMFTALFMTKFFFMLWMNKTQHTQLHMMNKFVGIKHDFLRGCKKLWAVSGSVFLLGCVALGFGAWNSVLGM 1116
89898635  1038 LTLIIGIFSSMFTALFMTKFFFMVWMNKTQETQLHMMNKFIGIKHDFLRECKRLWMVSGSVISLGCVALGFGAWHSVLGM 1117
62184819  1038 LTLILGIFSSMFTALFMTKFFFMVWMNKTQETQLHMMNKFIGIKHDFLKECKRLWMVSGSVIALGCVALGFGAWNSVVGM 1117
166155537 1032 LTLIIGIFSSMFTALFMTKFFFVIWVQKTRETQLHMMNKFIGIKHNFLKECKRLWVVSGVVLVLGCVGLGFGAWDSVFGM 1111
166154662 1032 LTLIIGIFSSMFTALFMTKFFFVIWVQKTRETQLHMMNKFIGIKHNFLKECKRLWVVSGVVLVLGCVGLGFGAWDSVFGM 1111
237802876 1032 LTLIIGIFSSMFTALFMTKFFFVIWVQKTRETQLHMMNKFIGIKHNFLKECKRLWVVSGVVLVLGCVGLGFGAWDSVFGM 1111
237804798 1032 LTLIIGIFSSMFTALFMTKFFFVIWVQKTRETQLHMMNKFIGIKHNFLKECKRLWVVSGVVLVLGCVGLGFGAWDSVFGM 1111
29839945  1118 DFKGGYAFTLDmSDQKAVDVVQFRNKLGDKFKQVGLSSRDFKIKTLDSSEKIKIYFSQNALTRVQASEKQVFET--PDPN 1195
15835348  1112 DFKGGYALTLD-SDVCAYNPDQMCSALKKRFREIGLSSRDYRVRKADSSGKVKIYFSQNALARVEQAKGGYSEQngADHH 1190
15836095  1117 DFKGGYAFTFNpKEHGISDVAQMRGKVVHKLQEAGLSSRDFRIQTFGSSEKIKIYFSDKALSYTKADTSLSPKI--NDHE 1194
15605175  1112 DFKGGYALTLD-SDVCEYNPEQMCSVLRKRFQQIGLSSRDYRVRRADSSEKVKIYLSQNALDRVEQIEGAGSEQkgSDYH 1190
15618475  1117 DFKGGYAFTFNpKEHGISDVAQMRGKVVHKLQEAGLSSRDFRIQTFGSSEKIKIYFSDKALSYTKADTSLSPKI--NDHE 1194
33241917  1117 DFKGGYAFTFNpKEHGISDVAQMRGKVVHKLQEAGLSSRDFRIQTFGSSEKIKIYFSDKALSYTKADTSLSPKI--NDHE 1194
16752475  1117 DFKGGYAFTFNpKEHGISDVAQMRGKVVHKLQEAGLSSRDFRIQTFGSSEKIKIYFSDKALSYTKADTSLSPKI--NDHE 1194
89898635  1118 DFKGGYALTLNmAEQKSVDVTQFRHTLGDKFKQVGLSSRDFKITTFDSSEKIKIYFSQNALARVQAPEIKVTEA--FDPH 1195
62184819  1118 DFKGGYALTLNmADQTSVDVTKFRSTLGDKFKQVGISPRDFRIKTFGSSDKIKIYFSQNALTRVQTPERPATDT--ADPN 1195
166155537 1112 DFKGGYALTLD-SDVCEYNPEQMCSVLRKRFQQIGLSSRDYRVRRADSSGKVKIYLSQNALDRVEQIEGAGSEQkgSDYH 1190
166154662 1112 DFKGGYALTLD-SDVCEYNPEQMCSVLRKRFQQIGLSSRDYRVRRADSSGKVKIYLSQNALDRVEQIEGAGSEQkgSDYH 1190
237802876 1112 DFKGGYALTLD-SHVCEYNPEQMCSVLRKRFQQIGLSSRDYRVRRADSSEKVKIYLSQNALDRVEQIEGAGSEQkgSDYH 1190
237804798 1112 DFKGGYALTLD-SHVCEYNPEQMCSVLRKRFQQIGLSSRDYRVRRADSSEKVKIYLSQNALDRVEQIEGAGSEQkgSDYH 1190
29839945  1196 LSLVMGILSDTGIDTSSESFKDTQNFWLKVSGQFSNKMRQQACIALAGALAIILLYVSLRFEWRYAFSAVCALIHDLVAT 1275
15835348  1191 LAQVLQVLSDSSDATSPAAFESSRGSWFKVSGQLSNKMRTQAIMALFGALGIILLYVSLRFEWRYAFSAICALMHDLLAT 1270
15836095  1195 LALAVGLLSETGLDFSTETLNETQNFWSKVSSKLSKKMRYQATIGLLGALAIILLYVSLRFEWQYAFSAVCALIHDLLAT 1274
15605175  1191 LARVLQVLSDSGSSTTSMVFDASRGSWFKVSGQLSNKMRTQAVIALFGALGIILFYVSLRFEWRYAFSAICALMHDLLAT 1270
15618475  1195 LALAVGLLSETGLDFSTETLNETQNFWSKVSSKLSKKMRYQATIGLLGALAIILLYVSLRFEWQYAFSAVCALIHDLLAT 1274
33241917  1195 LALAVGLLSETGLDFSTETLNETQNFWSKVSSKLSKKMRYQATIGLLGALAIILLYVSLRFEWQYAFSAVCALIHDLLAT 1274
16752475  1195 LALAVGLLSETGLDFSTETLNETQNFWSKVSSKLSKKMRYQATIGLLGALAIILLYVSLRFEWQYAFSAVCALIHDLLAT 1274
89898635  1196 LSVVMGILSDTGIDISSDSFKDTQNFWFKVSSQFSNKMRKQAFIALMGALFIILLYVSLRFEWRYAFSAICALIHDLVAT 1275
62184819  1196 LSIVMHILSDTGIDISSESLKDVQNFWFKVSGQFSNKMRQQAFIALMGALCIILLYVSLRFEWRYAFSAICALIHDLLAT 1275
166155537 1191 LARVLQVLSDSGSSTTSMVFDASRGSWFKVSGQLSNKMRTQAVIALFGALGIILLYVSLRFEWRYAFSAICALMHDLLAT 1270
166154662 1191 LARVLQVLSDSGSSTTSMVFDASRGSWFKVSGQLSNKMRTQAVIALFGALGIILLYVSLRFEWRYAFSAICALMHDLLAT 1270
237802876 1191 LARVLQVLSDSGSSTTSMVFDASRGSWFKVSGQLSNKMRTQAVIALFGALGIILLYVSLRFEWRYAFSAICALMHDLLAT 1270
237804798 1191 LARVLQVLSDSGSSTTSMVFDASRGSWFKVSGQLSNKMRTQAVIALFGALGIILLYVSLRFEWRYAFSAICALMHDLLAT 1270
29839945  1276 CAVLVATHFFLQKIQIDLQAVGALMTVLGYSLNNTLIIFDRIREDRQEKLFTPMPILINDALQKTLGRTVMTTATTLSVL 1355
15835348  1271 CSVLVALHFFLHRIQIDLQAVGALMTVLGYSLNNTLIIFDRIREDRREKLFTPMPILINDALQKTLGRTVMTTATTLSVL 1350
15836095  1275 CAVLFIAHFFLKKIQIDLQAIGALMTVLGYSLNNTLIIFDRIREDRQANLFTPMHVLVNDALQKTFSRTVMTTATTLSVL 1354
15605175  1271 CAVLVALHFFLQRIQIDLQAIGALMTVLGYSLNNTLIIFDRIREDRREKLFTPMPILINDALQKTLGRTVMTTATTLSVL 1350
15618475  1275 CAVLFIAHFFLKKIQIDLQAIGALMTVLGYSLNNTLIIFDRIREDRQANLFTPMHVLVNDALQKTFSRTVMTTATTLSVL 1354
33241917  1275 CAVLFIAHFFLKKIQIDLQAIGALMTVLGYSLNNTLIIFDRIREDRQANLFTPMHVLVNDALQKTFSRTVMTTATTLSVL 1354
16752475  1275 CAVLFIAHFFLKKIQIDLQAIGALMTVLGYSLNNTLIIFDRIREDRQANLFTPMHVLVNDALQKTFSRTVMTTATTLSVL 1354
89898635  1276 CAVLVATHFFLKKIQIDLQAVGALMTVLGYSLNNTLIIFDRIREDRQEKLFTPMPILINDALQKTLGRTVMTTATTLSVL 1355
62184819  1276 CAVLVATHFFLQKIQIDLQAVGALMTVLGYSLNNTLIIFDRIREDRQEKLFTPMPILINDALQKTLGRTVMTTATTLSVL 1355
166155537 1271 CAVLVALHFFLQRIQIDLQAIGALMTVLGYSLNNTLIIFDRIREDRREKLFTPMPILINDALQKTLGRTVMTTATTLSVL 1350
166154662 1271 CAVLVALHFFLQRIQIDLQAIGALMTVLGYSLNNTLIIFDRIREDRREKLFTPMPILINDALQKTLGRTVMTTATTLSVL 1350
237802876 1271 CAVLVALHFFLQRIQIDLQAIGALMTVLGYSLNNTLIIFDRIREDRREKLFTPMPILINDALQKTLGRTVMTTATTLSVL 1350
237804798 1271 CAVLVALHFFLQRIQIDLQAIGALMTVLGYSLNNTLIIFDRIREDRREKLFTPMPILINDALQKTLGRTVMTTATTLSVL 1350
29839945  1356 LILLFVGGGSIFNFAFIMTIGILLGTLSSLYIAPPLLLFMVRKEERNRQ 1404
15835348  1351 VILLFVGGGSIFNFAFIMTVGILLGTLSSLYIAPPLLLFMVRKEEQNSL 1399
15836095  1355 LMLLFIGGSSVFNFAFIMTIGILLGTLSSLYIAPPLLLFMVRKENRSK- 1402
15605175  1351 VILLFVGGGSIFNFAFIMTVGILLGTLSSLYIAPPLLLFMVRKEEQNSL 1399
15618475  1355 LMLLFIGGSSVFNFAFIMTIGILLGTLSSLYIAPPLLLFMVRKENRSK- 1402
33241917  1355 LMLLFIGGSSVFNFAFIMTIGILLGTLSSLYIAPPLLLFMVRKENRSK- 1402
16752475  1355 LMLLFIGGSSVFNFAFIMTIGILLGTLSSLYIAPPLLLFMVRKENRSK- 1402
89898635  1356 LILLFVGGGSIFNFAFIMTIGILLGTLSSLYIAPPLLLFMVRKEERQRL 1404
62184819  1356 LILLFVGGGSIFNFAFIMTIGILLGTLSSLYIAPPLLLFMVRKEERKQQ 1404
166155537 1351 VILLFVGGGSIFNFAFIMTVGILLGTLSSLYIAPPLLLFMVRKEEQNSL 1399
166154662 1351 VILLFVGGGSIFNFAFIMTVGILLGTLSSLYIAPPLLLFMVRKEEQNSL 1399
237802876 1351 VILLFVGGGSIFNFAFIMTVGILLGTLSSLYIAPPLLLFMVRKEEQNSL 1399
237804798 1351 VILLFVGGGSIFNFAFIMTVGILLGTLSSLYIAPPLLLFMVRKEEQNSL 1399
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap