Conserved Protein Domain Family
PRK12897

?
PRK12897: PRK12897 
type I methionyl aminopeptidase
Statistics
?
PSSM-Id: 171806
View PSSM: PRK12897
Aligned: 19 rows
Threshold Bit Score: 514.583
Threshold Setting Gi: 49184491
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
49479956    1 MITIKTKNEIDLMHESGKLLASCHREIAKIMKPGITTKEINTFVEAYLEKHGATSEQKGYNGYPYAICASVNDEMCHAFP 80 
42780769    1 MVTIKTKNEIDVMHESGKLLASCHREIAKIMKPGITTKEINTFVEAYLERHGATSEQKGYNGYPYAICASVNDEMCHAFP 80 
30019715    1 MSIIKTKNEIELMHESGKLLASCHREIAKMMKPGITTKEINTFVEAYLEQHGATSEQKGYNGYPYAICASVNDEMCHAFP 80 
118477115   1 MITIKTKNEIDLMHESGKLLASCHREIAKIMKPGITTKEINTFVEAYLEKHGATSEQKGYNGYPYAICASVNDEMCHAFP 80 
163939480   1 MITIKTKNEIDLMHESGKLLASCHREIAKMMKPGITTQEIDTFVEAYLEKHGATSEQKGYNGYPYAICASVNDEMCHGFP 80 
217959147   1 MITIKTKNEIDLMHESGKLLASCHREIAKIMKPGITTKEINTFVEAYLEKHGATSEQKGYNGYPYAICASVNDEMCHAFP 80 
218234969   1 MITIKTKNEIDLMHESGKLLASCHKEIAKMIKPGITTQEIDTFVEMYLKKYGAKSEQKGYNGYPYAICASVNDEMCHAFP 80 
222095294   1 MITIKTKNEIDLMHESGKLLASCHREIAKIMKPGITTKEINTFVEAYLEKHGATSEQKGYNGYPYAICASVNDEMCHAFP 80 
225863529   1 MITIKTKNEIDLMHESGKLLASCHREIAKIMKPGITTKEINTFVEAYLEKHGATSEQKGYNGYPYAICASVNDEMCHAFP 80 
301053202   1 MITIKTKNEIDLMHESGKLLASCHREIAKIMKPGITTKEINTFVEAYLEKHGATSEQKGYNGYPYAICASVNDEMCHAFP 80 
49479956   81 ADVPLTEGDIVTIDMVVNLNGGLSDSAWTYRIGKVSDEAEKLLLVAENALYKGIDQAVIGNRVGDIGYAIESYVANEGFS 160
42780769   81 ADVPLTEGDIVTIDMVVNLNGGLSDSAWTYRVGKVSDEAEKLLLVAENALYKGIDQAIIGNHVGDIGYAIESYVASEGFS 160
30019715   81 ADVPLTEGDIVTIDTVVNLNGGLSDSAWTYRVGKVSDEAEKLLLVAENALYKGIDQAVIGNHVGDIGYAIESYVTNEGFS 160
118477115  81 ADVPLTEGDIVTIDMVVNLNGGLSDSAWTYRIGKVSDEAEKLLLVAENALYKGIDQAVIGNRVGDIGYAIESYVANEGFS 160
163939480  81 SDVPLQEGDIVTIDMVVNLNGALSDSAWTYIVGDISDEAKRLLLVAESALYKGIEQAISGNHVGDIGYAIESYVASEGFS 160
217959147  81 ADVPLTEGDIVTIDMVVNLNGGLSDSAWTYRIGKVSDEAEKLLLVAENALYKGIEQAIIGNHVGDIGYAIESYVAAEGFS 160
218234969  81 ADVPLTEGDIVTIDMVVNLNGGLSDSAWTYRVGKVSDEAEKLLLVAENALYKGVDQAVIGNHVGDIGYAIESYVTNEGFS 160
222095294  81 ADVPLTEGDIVTIDMVVNLNGGLSDSAWTYRIGKVSDEAEKLLLVAENALYKGIEQAIIGNHVGDIGYAIESYVAAEGFS 160
225863529  81 ADVPLTEGDIVTIDMVVNLNGGLSDSAWTYRIGKVSDEAEKLLLVAENALYKGIDQAVIGNRVGDIGYAIESYVANEGFS 160
301053202  81 ADVPLTEGDIVTIDMVVNLNGGLSDSAWTYRIGKVSDEAEKLLLVAENALYKGIDQAVMGNRVGDIGYAIESYVANEGFS 160
49479956  161 VARDFTGHGIGKEIHEEPVIFHFGKQGQGPELQEGMVITIEPIVNVGMRYCKVDLNGWTARTMDGKLSAQYEHTIVITKD 240
42780769  161 VARDFTGHGIGKEIHEEPAIFHFGKLGQGPELQEGMVITIEPIVNVGMRYSKVDLNGWTAKTMDGKLSAQYEHTIAITED 240
30019715  161 VARDFTGHGIGKEIHEEPAIFHFGKQGQGPQLQEGMVITIEPIVNIGMRYSKVDLNGWTARTMDGNLSAQYEHTIAITKD 240
118477115 161 VARDFTGHGIGKEIHEEPAIFHFGKQGQGPELQEGMVITIEPIVNVGMRYCKVDLNGWTARTMDGKLSAQYEHTIVITKD 240
163939480 161 VARDFTGHGIGKEIHEEPAIFHFGKQGQGPELQEGMVITIEPIVNVGMRYSKVDLNGWTARTMDGKLSAQYEHTIAITKD 240
217959147 161 VARDFTGHGIGKEIHEEPAIFHFGKQGQGPELQEGMVITIEPIVNVGMRYSKVDLNGWTARTMDGKLSAQYEHTIAITED 240
218234969 161 VARDFTGHGIGKEIHEEPAIFHFGKQGQGPQLQEGMVITIEPIVNVGMRYSKVDLNGWTARTMDGKLSAQYEHTLAITKD 240
222095294 161 VARDFTGHGIGKEIHEEPAIFHFGKQGQGPELQEGMVITIEPIVNVGMRYSKVDLNGWTARTMDGKLSAQYEHTIAITED 240
225863529 161 VARDFTGHGIGKEIHEEPAIFHFGKQGQGPELQEGMVITIEPIVNVGMRYCKVDLNGWTARTMDGKLSAQYEHTIVITKD 240
301053202 161 VARDFTGHGIGKEIHEEPAIFHFGKQGQGPELQEGMVITIEPIVNVGMRYCKVDLNGWTARTMDGKLSAQYEHTIVITKD 240
49479956  241 GPIILTKL 248
42780769  241 GPIILTKL 248
30019715  241 GPIILTKL 248
118477115 241 GPIILTKL 248
163939480 241 GPIILTTL 248
217959147 241 GPIILTKL 248
218234969 241 GPIILTKL 248
222095294 241 GPIILTKL 248
225863529 241 GPIILTKL 248
301053202 241 GPIILTKL 248
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap