Conserved Protein Domain Family
ubiA

?
PRK12883: ubiA 
prenyltransferase UbiA-like protein; Reviewed
Statistics
?
PSSM-Id: 171796
View PSSM: PRK12883
Aligned: 7 rows
Threshold Bit Score: 442.246
Threshold Setting Gi: 242398699
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
57641892    1 MEFKAFIEITRPHNCLLAGIVGVLGSIVAAGGLPELKTAILVFLVVFLGCAGGNTINDYFDYEIDKINRPERPLPRGAMS 80 
14589988    1 MEPKAFVEIMRPHNCILAGIVGILGSLVAYEGIPPVQKLILIFLVVYFGCSAGNTINDYFDVEIDKINRPNRPIPRGAIT 80 
18978335    1 MEVKGFIEIMRPHNCILAGIVGILGALVAYEGIPDIKTLTLIFWVVYFGCSGGNTANDYFDYEIDKINRPNRPLPRGAMS 80 
161723322   1 MEVKAFIEIMRPHNCILAGVVGILGSLVAYEGIPSIEKLGLVFLVVYLGCSAGNTINDYFDVEIDRVNRPNRPIPRGAIP 80 
212225103   1 MELKAFIEITRPHNCILAGIVGLLGSIVALGHFPDPKTALLIFLVVTVGCAGGNTINDYFDYEIDKINRPERPLPRGAMG 80 
240103821   1 MELRAFVEITRPHNCALAGLVGVLGSMVALGSVPEGKILILVFLVVSLGCAGGNTINDYFDYEIDRINRPERPLPRGAMD 80 
242398699   1 MELKCFIEILRPINCLIAGLVGILGATVALGHLPPIKTSLLIFLVVFLECSWGNIINDYFDYEIDKINRPNRPLPRGALS 80 
57641892   81 RKAALWYSVALFATGIVLAWFINIWDFLLAIVAYVTMFIYAWKLKPMPFIGNVVVASLTGATPLYGAIAVGEIGLAGTLA 160
14589988   81 RKAAFYYGVLQYFIGLIIALLLGWSAFLFALGAYFLTFVYAWKLKPLPFIGNVTVALLTAATPIYGAVGVGRIDLAGYLA 160
18978335   81 RRAALYYALLQYAIGSILAYFLNIRAFVFATIAYFLTFLYGWKLKPLPLVGNITVAALTAATPIYGAIGVGRIGLAGYLA 160
161723322  81 RKVALYYALLQYMLGLALARFLGVEALLFALGAYALTFIYAWKLKPLPFIGNVAVALLTAATPIYGALGVGRVGLAGYLA 160
212225103  81 RKVALYYSMLLFAVGLALAYMINIYAFILGVIAYVTMFIYAWKLKPLPFVGNIVVAGLTGATPLYGAVAVEHLGLAGYLA 160
240103821  81 RRTALWYSLFLFAVGLALALLISLKAFAFALLAYITMFLYAWKLKPLPFIGNIAVAALTGVTPLYGAIAVGKIGLAGTLA 160
242398699  81 KNIALVYGISLGGVAILIAYLINFEAFIFALGAYLLMYLYARKLKPQPFIGNLVVATLTGITPIYGAIAVGKIGLAGYLA 160
57641892  161 LCAFLVNVAREVIKDIEDIEGDMAKGAKTLPILIGRKRAAYVGALFAILTVVASFLPIKAGIGLGYLAMLPVDAVILYSA 240
14589988  161 ICAFLVNVSREIMKDIEDFEGDKRLGARTLPIMIGKKKSGIIASIFGFLTIISSFLPVKVGIGLGYLPIIIVDIMIAKAS 240
18978335  161 ICAFLVNVSREIMKDIEDIEGDKALGARTLPIIIGEKKAAIIAAIFGFLTVIASFLPVKVGIGLGYAPIIIVDIIIIKAS 240
161723322 161 ICAFLVNVSREIMKDIEDIEGDMKMGAKTLPIIIGKRRAAMISSIFGVLTVITSFLPVKVGIGLGYAPIILVDAMILKAS 240
212225103 161 ICAFLVNVAREVIKDIEDVEGDMAKGAKTLPIIWGKKRAAYVGVLFALLTVIASFLPVKASVGVGYYAMVPVDLLILYAA 240
240103821 161 VCAFLVNVAREIVKDIEDVEGDLKKGAKTLPIILGRRKAAYVAAFFGVATVIASFLPVKAGVGVGYYAMVPVDLIILYAV 240
242398699 161 LCAFLVNVAREIFKDIEDIEGDKAQGAKTLPIVWGIESSSKIGVIFSVATIIASLLPVKAGIGLGYFPIIIVDGIILWAA 240
57641892  241 FLILRSQdrETAHRAQILLKVSVFLAVVAFLIASLVR 277
14589988  241 IDVLVNP--EKAGKGQKILKFATFIAVISFLLGALTR 275
18978335  241 IDVLRDP--KAASKGQKLLKIATFVAVISFLAGALTK 275
161723322 241 IDVVKNP--ESASKGQKTLKIATFIAVISFLLGALTK 275
212225103 241 YLILRNQdrEVAHKSQKLLKMSIFLAVMAFLIAAIV- 276
240103821 241 YLILRNQdeKTAHRSQLLLKASIFLAVFAFLIAALM- 276
242398699 241 YEVLKNPspKTAGRVQKKLKIAIYLAVFSFLLGSITK 277
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap