Conserved Protein Domain Family
ubiA

?
PRK12873: ubiA 
4-hydroxybenzoate polyprenyltransferase
Statistics
?
PSSM-Id: 171787
View PSSM: PRK12873
Aligned: 18 rows
Threshold Bit Score: 424.844
Threshold Setting Gi: 148241785
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
113954511   1 MLFRQTLAPWVALLRWNKPSGRLILLIPAGWSLWLTPDAPPSLALVLMIVLGGLAVSGAGCIANDLWDRRIDRNVERTKQ 80 
33863595    4 RSFSNGLRQWLELLRWHKPSGRLILLVPAGWSLWLTPDAPPLAGLVSLIVVGGLMVSGAGCIANDLWDRRIDRQVERTRE 83 
78212172    4 ISSSARLQPWIELLRWNKPTGRLILLIPAGWALWLNPTAPPSLVLILQILLGGLAVSGAGCIANDLWDQRFDGKVERTKR 83 
124025222   1 ------MGYYFQLLRWNKPSGRLILLIPSGWSLWLTPAAPPSLLFLGIIILGGLFVSGAGCIANDIWDRKFDKKVIRTKE 74 
124022368   4 RSVSNGLRQWLELLRWHKPSGRLILLVPAGWSLWLTPDAPPLAGLVSLIVVGGLMVSGAGCIANDLWDRRIDRQVERTRE 83 
33866379    2 DSIRERLGPWLELLRWTKPTGRLILLIPAGWSLWLSPSAPPGLDLLLQIVVGGLAVSGAGCIANDLWDRRFDGRVERTKQ 81 
72383624    1 ------MGYYFQLLRWNKPSGRLILLIPSGWSLWLTPAAPPSLLILGIIILGGLFVSGAGCIANDIWDRKFDKKVIRTKE 74 
33239907    4 FLLTKKLLNIFHLLRWNKPTGRLILLIPAGWSLWLTPNAPPSKELVTLIIAGAISVSGAGCIANDLWDRKIDSKVKRTKN 83 
78185306    2 NSSIPSLRPWIELLRWNKPSGRLILLIPAGWSLWLTPSAPPSASLVGVILVGGLAVSGAGCIANDLWDQGFDRQVERTQG 81 
148240192   4 TLPSRLMSPWVALLRWNKPSGRLILLIPAGWSLWLNPAGPPSLQLILQILIGGLSVSAAGCVANDLWDQRIDREVARTSQ 83 
113954511  81 RPLAQGSLSVAQAVVVLIVMLVISLGVVLNLPDSVRNLCFVLACLALPPILIYPSAKRWFAYPQAVLALCWGFAVLIPWA 160
33863595   84 RPLAKGSIRICTAVGLLIVLLLLSLLVVASLPTPSQRLCLALAILALPPILLYPSAKRWFAYPQAVLALCWGFAVLIPWA 163
78212172   84 RPLARGALQRGPAFALLLTLLGLSLAVVLSLPADSLRLCLALACTAVLPILGYPSAKRWFAFPQVILALCWGFAVLIPWA 163
124025222  75 RPLANGKVSLKAAWILLILMLFFSLFIVLSIPQESRNLCLLLSSLSLPFILLYPSAKRWFQYPQLILSICWGFSVLIPWA 154
124022368  84 RPLAKGSIRISTAVGLLIVLLLLSLLVVVSLPTPSRGLCLALAILALPPILLYPSAKRWFAYPQAVLALCWGFAVLIPWA 163
33866379   82 RPLARGAIRPTSALVLLIVLLSLSLAVVLSLDEASRQLCLLLSIGALPAILLYPSAKRWFAYPQAVLAFCWGFAVLIPWA 161
72383624   75 RPLANGKVSLKAAWILLILMLFFSLFIVLSIPQDSRNLCLLLSSLSLPFILLYPSAKRWFQYPQLILSICWGFSVLIPWA 154
33239907   84 RPLANGSLSIVEAFSLLIFLLIISLKVILLLPTPSQNLSLKLAAMALVPILIYPSSKRWFRYPQVLLAFCWGFAVLIPWA 163
78185306   82 RPLARGALQRPQALCLLLVLLLVSLGVVLSLSDESRGLCLGLAVAALPPILLYPSAKRWFAFPQAVLALCWGFAVLIPWA 161
148240192  84 RPLARGDLNRVQAFTLLAVLLTLSLLVVISLPGDVRWLCLQLAVLALPPILFYPSAKRWFPFPQAILALCWGFAVLIPWA 163
113954511 161 AQTGDLNGGWPLAGCWVATLLWTFSFDTVYAMADRPDDARMALNSSALTLGSSVLRVVGVTYALSMLALAVAAACAGIGV 240
33863595  164 ASQANLKGGWPLLGCWLATLMWTFGFDTVYAMADRRDDANLALKSSALSLGSHALKTVAFSYALACTFLASSAVSAGVGW 243
78212172  164 AATASLSWSPVLVCSWVATVVWTFGFDTVYAMADRRDDASLGLRSSALSLGSSVVPVVRGCYLVTAITLAMAAWSAQIPA 243
124025222 155 ASESSLA-GVTLIYCWLATILWTFGFDTVYAMADESEDKVIGLNSSAISLGGKSLKTVSLCYFLTCIFLALAAFKANLGL 233
124022368 164 ASQANLNGGWPLLGCWLATLMWTFGFDTVYAMADRRDDANLALKSSALSLGSHALKTVAFSYALACTFLASAAMSAGVGW 243
33866379  162 AAERSLTLQPALIGCWLATLLWTFGFDTVYAMADRRDDALIGLNSSALSLGNRAVVTVRACYVLTVVALGVAAASAGVHP 241
72383624  155 ASESSLAGGVTLLFCWLATILWTFGFDTVYAMADESEDKVIGLNSSAISLGGKSLKTVSLCYFLTCIFLALAAFKANLGL 234
33239907  164 ASEHSLNGGFPLLTCWLATMVWTFGFDTVYAMADKDDDKKLGLQSSALSLGQKALKSVFICYALTSTLIAFSALTKDIGI 243
78185306  162 AAEGQLSWNPALISCWIATLLWTFGFDTVYAMADRRDDAQIGLRSSALSLGESATSVVRICYALTCFSMAIAATTAQVAA 241
148240192 164 AATGSLSISLPLLATWGATLCWTFSFDTVYAMADRVDDAKLKLRSSALTLGDSAVRVVRAGYGLTAAGLAMAAAATQAGV 243
113954511 241 IFWPFWLVVTFGMQRATRALNSvRQQSMSVYGVHFSHQVRLGALLLLGLVLGRLG 295
33863595  244 AFWPFWLIASIGMQKETWTLRG-SNQPITTYGQHFQHQVLLGAMLLLGLILGRIS 297
78212172  244 PFWLLWLLATVFMQLSCNPLNQ-QDAPMSTYGKHFAQQVQAGTLLWLGLVLARGW 297
124025222 234 IYWPFWLITTVGMQREVFLLSS-KSKGIKTSGLHFSNQVRLGSLLLLGMVFSKII 287
124022368 244 AFWPFWLIASIGMQKETWTLRG-SNQPMTTYGQHFQHQVLLGAMLLLGLILGRIS 297
33866379  242 LFWIFWLGASLLMQISCQSLNH-RNATMASFGLHFRRQVQLGSLLLLGLIVSRGL 295
72383624  235 IYWPFWLITTLGMQREVFLLSS-KSKGIKTSGLHFSNQVRLGSLLLLGMVFSKII 288
33239907  244 IFWPFWLIASIGMQKEVFSLKE-LEANTNKFGKHFRNQVFLGGLILFGLILGNF- 296
78185306  242 PFWPFWLMATVLMQVSCSPLTR-EKASMVLFARHFSRQVQVGSLLLIGLCLARAW 295
148240192 244 IFWIVWAVACIGFWRSTLPLKAkKQQAPSVYANHFARQVQLGSLLLAGVILSRLG 298
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap