Conserved Protein Domain Family
ubiA

?
PRK12871: ubiA 
prenyltransferase; Reviewed
Statistics
?
PSSM-Id: 106000
View PSSM: PRK12871
Aligned: 5 rows
Threshold Bit Score: 435.784
Threshold Setting Gi: 126180357
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
126180357   1 MRETLAAFADLTRAHFFFVWPLLFCSGLALAFANYGGFSWELVGRAALIGLFGFEAGFVLNDYVDREYDRRDVDGSLTRY 80 
73669199    1 MIETLKAYLDLIRAHFLPAWPLVSCSGLVLAFANYGGFSWALTIKVALIGLLGFEAGFILNDYVDRKRDRLDVENTLTRY 80 
21228044    1 MKETLKSYLDLTRAHFLPAWPLVFCSGLVLAFANYGGFSWELIIKAALIGLFGFEAGFVLNDYVDRNRDRLDVENTMTRY 80 
20089675   74 TKETIKALIDLTRAHFSLVWILLFYSGLVLAFKNYGEFSREITFKAVLIGLFGFEGGLVLNDYVDRKRDRLDVEGALTVY 153
20089674   17 MKETLKAYIDLTRVHFLPAWPLIFCSGLVLAFANYGGFSWALILKAALIGLLGFEAGFVLNDYVDRNRDKLDVENTMTRY 96 
126180357  81 WRPFGERPIPAGKLSPGAAFAVFLVLAGLAAALAATLPSPHNLYVLGIMGYSYLVEYFYQTKKRNQTVPVAQMVGRTDFA 160
73669199   81 WRPFKERPIPSGKVSSKNAFLLFILLVAVVSALILTLPYPNSLYVFVVMLYSYSIEAFYQIKKRNQNYPIAQLLGRTDFT 160
21228044   81 WRPFKERPIPSGRISSKNAFWLFILLALVTSALIFTLPYPNSLYVFAIMLYSYGIEAFYQVKKRDQKLPVAQLLGRTDFT 160
20089675  154 WRPFKSRPLPSGRLSPAFALALFLLFSALTGVLMLTLPFPNSLYVFITMLSSCIIEYFYQVKRKNQSFPVAQLVGRMDFT 233
20089674   97 WRLFKERPIPSGKISSKNAFWLFILLVGVTSALIFTLPYPNSLYVFVIMLYSYGIEAFYQVKKRDQKYPVAQLLGRTDFT 176
126180357 161 LFPVAGYLVYGNPDATALLFFLFFYPWTLAHLGANDIADIVNDRARGMATIpsltfgltgsapedptPVLYGMKGAAAWV 240
73669199  161 LFPAAGYLCYGHPDMTMLLYMFFFYPWTMAHLGLNDFIDLKNDRSRDMKSI----------------AVLYGEKGTMYWI 224
21228044  161 LFPAAGYLCYGQPDMTILLYMVFFYPWTMAHLGLNDFIDLENDRAREMKSI----------------AVLYGAKGSMYWV 224
20089675  234 LFPVAGYLCYGKPDTTLLLYLVFFYPWTLSHLAVNDFIDTENDRARGIKSI----------------PVLYGLEGTLFWI 297
20089674  177 LFPAAGYLCYGQPDMTVLLYMVFFYPWTMAHLGLNDFIDLENDRARGMKSI----------------AVLYGSKGAMYWV 240
126180357 241 LGFSAIHAGMALVFGLTLGPIAIAGFGAGLILLGAANYLILRGKTADAAMRALPLMHASLLIYAAAIIAGAVL 313
73669199  225 TGFTALHFLAAIFFLQELGEIAFYGFLVGFVLLAGANLYLWKEKNPGAGMKILPVYHGVLIIYAVSIILDFIY 297
21228044  225 TGFTLLHFFMSIFFLRELGNIALYGFFAGFVLLAGSNLYLWREMSPGAGMKILPIYHSTLVIYAVSIILDFIY 297
20089675  298 FGFTLLHYLAALLFLKQLGDIALYGFLLGFLVLGFANYKLLKEKSQRAGLFALFLFHVSLVLYSCSIIFDSFS 370
20089674  241 TGFTVLHFLAAIFFLRELGTIALYGFLAGFVLLAGSNLYLWKEKSQDAGMKILPVYHMTLVIYSVSIILDFMY 313
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap