Conserved Protein Domain Family
PRK12865

?
PRK12865: PRK12865 
YciI-like protein; Reviewed
Statistics
?
PSSM-Id: 171782
View PSSM: PRK12865
Aligned: 10 rows
Threshold Bit Score: 163.465
Threshold Setting Gi: 222150052
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116254221  1 MLFALLCKDKPGHLNVRMDTRPTHIEHLNKLNAEGTLKIAGPFLDDDGKPCGSLIIVEAESKEAARALADADPYAKAGLF 80 
15966829   1 MLFALLCTDKPGALQLRLDTRPDHVAYLNDLNARGILKIAGPFLGADGKPTGSLVIVKADTLEEARALAEADPYAKVGLF 80 
86359482   1 MLFALLCKDKPGHLNVRIETRPTHLAYLDKLNAEGKLSMAGPFLDDEGKACGSLVLVKAETAQEAKALADADPYAVAGLF 80 
15889905   1 MLFAFICKDKPGHLNVRMETRPAHLEHLNRLNAEGTLKIAGPFLDAEGKPNGSLVIVEASDIDAAKALADADPYAKAGLF 80 
190893750  1 MLFALLCKDKPGHLDVRMDTRPTHLEYLNRLNAKGTLKIAGPFLDDEGKACGSLIIVEAESKEAARALADADPYAQAGLF 80 
209551268  1 MLFALLCKDKPGHLNVRMETRPTHLEYLNGLNAEGTLKIAGPFLDDEGKACGSLIIVEAETKEAARALADADPYAKAGLF 80 
222150052  1 MLFAVICADKPNHLDLRMATRPPHVEWLNGLNADGVLKIGGPFLDADGKPCGSMLLIKADDLAAAKAIAAEDPYAKAGLF 80 
222087473  1 MLFAFVCKDKPGHLNVRMDTRPAHVEHLNKLNAEGTLKIAGPFLDADGKPNGSLVIVNADTIEAAKAIADSDPYAKAGLF 80 
227823727  1 MLFALICTDKPGALQLRLDTRPDHLAYLNDLNVKGILKIAGPFLGEDGKPTGSLVIVKAETIDAAKAIAEADPYAKAGLF 80 
241206701  1 MLFALLCKDKPGHLNVRMDTRPTHIEHLNKLNAEGKLKIAGPFLDDDGKPCGSLIIVEAESKEAARALADADPYAKAGLF 80 
116254221 81 ESVEVKAYNWVFNKPEA 97 
15966829  81 ANVEIKAYNWVFNNPEA 97 
86359482  81 ESVDIKPFNWVFNKPEA 97 
15889905  81 ESVDVKPYNWVFNNPGA 97 
190893750 81 ESVEVRAYNWVFNKPEA 97 
209551268 81 ESVDVKAYNWVFNKPEA 97 
222150052 81 ESVEIKPYNWVFNNPEA 97 
222087473 81 ESVEVKPFNWVFNNPEA 97 
227823727 81 ANVEIKAYNWVFNNPEA 97 
241206701 81 ESVDVKAYNWVFNKPEA 97 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap