Conserved Protein Domain Family
PRK12856

?
PRK12856: PRK12856 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 105987
View PSSM: PRK12856
Aligned: 21 rows
Threshold Bit Score: 148.975
Threshold Setting Gi: 152974604
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
47526280    1 MIVTTTSGIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGGRAGSYESKLKEARDIAMDEMKELAKQKGANAIVGV 80 
42780171    1 MIVTTTSGIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGGRAGSYESKLKEARDIAMDEMKELAKQKGANAIVGI 80 
163938909   1 MIVTTTSGIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGGRAGSYESKLKEARDIAMDEMKELAKQKGANAIVGI 80 
218896064   1 MIVTTTSGIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGGRAGSYESKLKEARDIAMGEMKELAKQKGANAIVGI 80 
222094739   1 MIVTTTSGIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGGRAGSYESKLKEARDIAMDEMKELAKQKGANAIVGV 80 
225862949   1 MIVTTTSGIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGGRAGSYESKLKEARDIAMDEMKELAKQKGANAIVGV 80 
229604910   1 MIVTTTSGIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGGRAGSYESKLKEARDIAMDEMKELAKQKGANAIVGV 80 
227816143   1 MIVTTTSGIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGGRAGSYESKLKEARDIAMDEMKELAKQKGANAIVGV 80 
301052643   1 MIVTTTSGIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGGRAGSYESKLKEARDIAMDEMKELAKQKGANAIVGV 80 
296501724   1 MIVTTTSGIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGGRAGSYESKLKEARDIAMDEMKELAKQKGANAIVGV 80 
47526280   81 DVDYEVVRDGMLMVAVSGTAVRI 103
42780171   81 DVDYEVVRDGMLMVAVSGTAVRI 103
163938909  81 DVDYEVVRDGMLMVAVSGTAVRI 103
218896064  81 DVDYEVVRDGMLMVAVSGTAVRI 103
222094739  81 DVDYEVVRDGMLMVAVSGTAVRI 103
225862949  81 DVDYEVVRDGMLMVAVSGTAVRI 103
229604910  81 DVDYEVVRDGMLMVAVSGTAVRI 103
227816143  81 DVDYEVVRDGMLMVAVSGTAVRI 103
301052643  81 DVDYEVVRDGMLMVAVSGTAVRI 103
296501724  81 DVDYEVVRDGMLMVAVSGTAVRI 103
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap