Conserved Protein Domain Family
PRK12855

?
PRK12855: PRK12855 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 171774
View PSSM: PRK12855
Aligned: 13 rows
Threshold Bit Score: 153.294
Threshold Setting Gi: 42784330
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
49478903    1 MIVTTTSTIQGKEIIDYVDIVNGEAIMGANIVRDLFASVRDVVGGRSGAYESKLKEARDIAMEEMKTLARQKNANAIVGI 80 
52140386    1 MIVTTTSTIQGKEIIDYVDIVNGEAIMGANIVRDLFASVRDVVGGRSGAYESKLKEARDIAMEEMKTLARQKNANAIVGI 80 
162382768   1 MIITTTSTIQGKEIIEYVDIVNGEAIMGANIVRDLFASVRDVVGGRSGAYESKLKEARDIAMEEMKTLARQKNANAIVGI 80 
42784330    1 MIVTTTSTIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGGRAGAYESKLKEARDIAMEEMKTFARQKNANAIVGI 80 
30023214    1 MIVTTTSTIQGKEIIDYVDIVNGEAIMGANIVRDLFASVRDVVGGRSGAYESKLKEARDIAMEEMKTLARQKNANAIVGI 80 
163942864   1 MIVTTTSTIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGGRAGAYESKLKEARDIAMEEMKTLARQKNANAIVGI 80 
218233507   1 MIVTTTSTIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGGRAGAYESKLKEARDIAMEEMKTFARQKNANAIVGI 80 
217962659   1 MIVTTTSTIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGGRSGAYESKLKEARDIAMEEMKTLARQKNANAIVGI 80 
218906354   1 MIVTTTSTIQGKEIIDYVDIVNGEAIMGANIVRDLFASVRDVVGGRSGAYESKLKEARDIAMEEMKTLARQKNANAIVGI 80 
225867142   1 MIITTTSTIQGKEIIEYVDIVNGEAIMGANIVRDLFASVRDVVGGRSGAYESKLKEARDIAMEEMKTLARQKNANAIVGI 80 
222098633   1 MIVTTTSTIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGGRSGAYESKLKEARDIAMEEMKTLARQKNANAIVGI 80 
296505593   1 MIVTTTSTIQGKEIIDYVDIVNGEAIMGANIVRDLFASVRDVVGGRSGAYESKLKEARDIAMEEMKTLARQKNANAIVGI 80 
301056641   1 MIVTTTSTIQGKEIIDYVDIVNGEAIMGANIVRDLFASVRDVVGGRSGAYESKLKEARDIAMEEMKTLARQKNANAIVGI 80 
49478903   81 DVDYEVVREGMLMVAVSGTAVRI 103
52140386   81 DVDYEVVREGMLMVAVSGTAVRI 103
162382768  81 DVDYEVVREGMLMVAVSGTAVRI 103
42784330   81 DVDYEVVREGMLMVAVSGTAVRI 103
30023214   81 DVDYEVVREGMLMVAVSGTAVRI 103
163942864  81 DVDYEVVREGMLMVAVSGTAVRI 103
218233507  81 DVDYEVVREGMLMVAVSGTAVRI 103
217962659  81 DVDYEVVREGMLMVAVSGTAVRI 103
218906354  81 DVDYEVVREGMLMVAVSGTAVRI 103
225867142  81 DVDYEVVREGMLMVAVSGTAVRI 103
222098633  81 DVDYEVVREGMLMVAVSGTAVRI 103
296505593  81 DVDYEVVREGMLMVAVSGTAVRI 103
301056641  81 DVDYEVVREGMLMVAVSGTAVRI 103
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap