Conserved Protein Domain Family
groEL

?
PRK12851: groEL 
chaperonin GroEL; Reviewed
Links
?
Statistics
?
PSSM-Id: 171770
View PSSM: PRK12851
Aligned: 13 rows
Threshold Bit Score: 772.375
Threshold Setting Gi: 86741209
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
86361060    1 MAAKEVKFSVEAREKMLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELEDKFENMGAQMVREVASK 80 
116249497   1 MAHKQVLFHAEARGKVLQGATKLADAVRITLGPRSKSVLIEKKWGAPIVCNDGVTIAKEFDLKDPEENLGARMLRAAAEK 80 
91783188    1 MSAKDVKFHDSARSRIVKGVNVLADAVKVTLGPKGRNVLIERSFGAPTITKDGVSVAKEIELKDRFENMGAQVVKQVASK 80 
162139904   1 -MAKMIAFDEEARRGLERGMNRLADAVKVTLGPKGRNVVLANKFGLPTITNDGVSIAREIELENSYERIGAELVKEVAKK 79 
86741209    1 -MAKDLRFNVEARRLLEAGVNALADAVKVTLGPKGRNAVIEKLTGPPTITNDGVTIAREIQLRNPFANMGAQLVKEVATK 79 
16264754    1 MAAKEVKFQTDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELEDKFENMGAQMLREVASR 80 
13472184    1 MAAKEVKFHSDAREKMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEIELEDKFENMGAQMVREVASK 80 
150396499   1 MAAKEVKFQADARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELEDKFENMGAQMLREVASK 80 
190894865   1 MAAKEVKFNVEAREKLLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELEDKFENMGAQMVREVASK 80 
27379746    1 MAHKQVLFHSAAREKILRGASLLADAVRVTLGPKSKSVLIQKGWGAPIVCNDGVTIAKEFDLKDAEENLGAQVLRQLAEK 80 
226944660   1 MAKSRILFRNAAREKVLQGATQLADAVRVTLGPKSKSVLIQRQWGPPTVCNDGVTIAKQVSLEDAEENLGAAMLRQAAER 80 
227818754   1 MAAKEVRFHTEAREKMLRGVDILANAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKEIELEDKFENMGAQMVREVASK 80 
227818822   1 MAAKEVRFHTDAREKMLRGVDILANAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKEVELEDKFENMGAQMVREVASK 80 
86361060   81 TSDIAGDGTTTATVLAQAIVKEGAKAVTSGMNPMDLKRGIDLAVSAIVEELKANARKISNNAEIAQVGTISANGDAEIGR 160
116249497  81 TGEVVGDGTSTSTVLAHAILADGHRNVVAGASAIDLKRGLERAVSRAVRALRDISRPVTTDREKQQVAAISAHNDETIGK 160
91783188   81 TADVAGDGTTTATVLAQSIVQEGMKHVAAGMNPMDLKRGIDKAVAAVLDELHRLSKPIKTSREIAQVGAISANADEAIGK 160
162139904  80 TNDVAGDGTTTATILAQALVREGLRNVAAGANPLGLKKGIEVAVERVSEELSKQAKEVETKEQIASTASISA-GDSAIGG 158
86741209   80 TNGTAGDGTTTATVLAQALVREGLHAVDGGANPMFLKNGIEAAVAALLEEFEKYRGEVEGEADLARVATLAANNDARIGD 159
16264754   81 TNDLAGDGTTTATVLAQAIVREGAKAVASGMNPMDLKRGIDLAVDAVVKELKNNARKISKNSEIAQVGTISANGDTEIGR 160
13472184   81 TSDLAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGIDKAVEAIVQELKTNARKVTRNDEIAQVGTISANGDAEIGR 160
150396499  81 TNDLAGDGTTTATVLAQAIVREGAKAIASGMNPMDLKRGIDLAVDAVVKELKSNARKISQNSEIAQVGTISANGDTEIGR 160
190894865  81 TSDIAGDGTTTATVLAQAIVKEGAKAVTSGMNPMDLKRGIDLAVAAIVAELKANARNISNNSEIAQVGTISANGDAEIGR 160
27379746   81 TGDVVGDGTSTSTILAHAILSDGVRNVVAGASAIDLKRGLDRGTQAAIAALRAMATPVKSRAEKVQVATISAHNDASIGE 160
226944660  81 TGEAVGDGTSTSTVLAQAIFADGVRNVVAGASGIDLKRGLDRGLQVAVDSLKAQSRPVLERKEKAQVASISAHNDDEIGE 160
227818754  81 TSDIAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGVDKAVDAVVEELRRNARKVTKNDEIAQVGTISANGDTEIGR 160
227818822  81 TSDIAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGIDKAVDAIVEELKTNARRVTKNDEIAQVGTISANGDIEIGR 160
86361060  161 FLAEAVQKVGNDGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNADKMRVEFEDPYILIHEKKLSNLQSMLPILEAV 240
116249497 161 LVAEAMAKVGKEGVITVEESKTMETRLDVVEGMQFDRGYISPYFATDAEKMESILEDARILIFDRKISALGELVAPLEEI 240
91783188  161 IIADAMDKVGKEGVITVEDGKSLENELEVVEGMQFDRGYLSPYFINDPDKQVAHLDDPLILLHDKKISSIRDLLPVLEAA 240
162139904 159 LIAEALDKVGKEGVVTVEESNTFGLELELTEGMRFDKGYISPYFVTDADRQEAVLDDPYILIVNSKIAAVKDLLPLLEKV 238
86741209  160 VVAAALGRVGCDGVVTVEESPIFGLEVSFVDGIELDNGYLSPYMVTDTERMEAAYTDPYILLTNEKISQVQTLMPVLELV 239
16264754  161 YLAEAMEKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFITNQDKMRVELEDPYILIHEKKLSNLQAMLPVLEAV 240
13472184  161 FLAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFITNQDKMRVELEEPYVLIHEKKLSNLQALLPVLEAV 240
150396499 161 YLAEAMEKVGNEGVITVEEAKTSDTELEVVEGMQFDRGYLSPYFVTNQDKMRVELEDPYILIHEKKLSNLQSILPVLEAV 240
190894865 161 FLAEAMEKVGNDGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNADKMRVEFEDPYILIHEKKLSNLQSMLPILEAV 240
27379746  161 LVADAIEKVGGDGVISVEESKTTETLLDVVEGMKFDRGFLSPYFITDADRMESVLQDPYVLLCDHKIGALRDLVPLLEQV 240
226944660 161 LVAEAMEKVGGEGVITVEESKTTETILEVVEGMQFERGYVSPYFVSDPEKMQAVLEDAFVLLCEQKVSLLQDLIPLLEEV 240
227818754 161 FLAEAMEKVGNEGVITVEEAKTAVTELEVVEGMQFDRGYLSPYFVTNPDKMRVELEEPYVLIHEKKLSNLQALLPVLESV 240
227818822 161 FLAEAVEKVGNEGVITVEEAKTAVTELEVVEGMQFDRGYLSPYFVTNPDKMRVELEEPYLLIHEKKLSNLQALLPVLESV 240
86361060  241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTAGTVISEDLGIKLENVTLNMLGRA 320
116249497 241 AKSGRPLLVIAEDVEGEALATLIVNQIRGTFRNCAVKAPGFGDRRKEMLQDLAILTGAQLISEDLGFKLDKVTLEQLGTA 320
91783188  241 AKAGKPLLIIAEDVEGEALTTLVVNSMRGVLKVAAVKAPGFGDRRKALLEDIAILTGATVISEETGKQLEKATLEELGRA 320
162139904 239 MQTSKPLVIISEDVEGEALATLVVNKIRGTFKSVAVKAPGFGDRRKAILGDIAILTGGQVISEDVGLKLESTSLDLLGRA 318
86741209  240 TRAGGQLIVFAENVEGPALGMLVANNVHGTFRSAVVRAPGFGHRRLAELNDLAVFLGGQVITADAGLSLDRVTLGQLGRC 319
16264754  241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTVVSEDLGIKLESVTLDMLGRA 320
13472184  241 VQSSKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTAISEDLGIKLENVTLEMLGRA 320
150396499 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTVVSEDLGIMLENVTLEMLGRA 320
190894865 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAVLTAGTVISEDLGIKLESVTLDMLGRA 320
27379746  241 AKSGQPLLIIAEDIEGEALATLIVNQLRGVLKACAVKAPGFGDRRKAMLEDIAILTGAQVISEEIGLNLENATLQQLGRA 320
226944660 241 AKAGRPLLFVAEDIEGEALATLILNHIRGVLHAVAVKAPGFGDRRKEMLEDIAVLTGGEVISRDLGRSLADTTLAQLGRI 320
227818754 241 VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTAISEDLGIKLENVTLDMLGRA 320
227818822 241 VQSGKPLLIIAEDVEGEALATPVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTAISEDLGIKLENVTLNMLGRA 320
86361060  321 KKITVEKENTTIIDGVGSKEEISGRIAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDAL 400
116249497 321 TRVVVDKETTTIIGGGGTQQAMKGRADQIRKQIEKTTSDYDKEKLQERLAKLSGGVAVIRVGAPAEAEMKAKKDALDDAI 400
91783188  321 KRVEVQKENTIIIDGAGDQTRIDARVKAIRAQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDAL 400
162139904 319 RKIVVTKDETTVVEGSGDPDQIAGRVSQIRNEIDKSDSDYDREKLQERLAKLAGGVAVIKVGAATEVELKEKKHRIEDAV 398
86741209  320 KKATITEHATTIVDGAGSATEIHARIDQLKRELERAENPHDQDTLQTRIARLSGGVAVIRVGAVTGVELKEKLHRVEDSL 399
16264754  321 KKVSIEKENTTIIDGAGSKADIEGRTAQIRAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDAL 400
13472184  321 KKVVIEKENTTIVDGAGSKDEIQGRVSQIKSQIEETTSDYDKEKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDAM 400
150396499 321 KKVSIEKENTTIIDGAGSKTEIEGRTAQIRAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDAL 400
190894865 321 KKVSVEKENTTIVDGSGAKSDIEGRIAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDAL 400
27379746  321 ARVVADKENTTLIGSGGDRTRIDARLGQIRVEIEKTTSDYDREKLEERLAKLSGGVAVIRVGAPTEAEMKAKKEALDDAI 400
226944660 321 QRVVVDKETTTLIGGAGDSAALESRMKQIRAQIDKTAGDYDREKLQERLAKLSGGVAVIRAGAPTEAEMKARKDALDDAI 400
227818754 321 KKVVVEKENTTIVDGAGSKTEIEGRVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDAM 400
227818822 321 KKVVVEKENTTIVDGAGSKSEIQGRVAQIRAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDAM 400
86361060  401 HATRAAVEEGILPGGGVALLRAVKALDNIKTA-NDDQRVGVEIVRRALEAPARQIAENAGAEGSVVVGKLREKSDfSYGW 479
116249497 401 NATKAAVEEGIVPGGGLALLRCMKAVAEEEELcDGDERTGVQILKRSLEVPARQIAENSAVDGGVVVARMLEGEG-SIGF 479
91783188  401 HATRAAVEEGIVPGGGVALLRARSAISSLTGA-NADQDAGIRIVLRALEAPLRVIAANAGDEPSVVVAKVLSGKG-NYGY 478
162139904 399 SNAKAAVEEGIVAGGGVALLQASITAFEKLDL-SGDEATGANIVRLALEAPIKQIAFNSGLEGGVVVDKVRNLPT-GHGL 476
86741209  400 AAARAALAEGVVAGGGTALLQAASALDKLTL--TGDAAEGREIVRRAIAEPLRWIAINAGYDGDEVVKRVAELPR-GHGF 476
16264754  401 HATRAAVEEGILPGGGVALLRAVKALDGLKTA-NNDQRVGVDLVRRAIEAPVRQIAENAGAEGSIIVGKLREKTEfSYGW 479
13472184  401 HATRAAVEEGVLPGGGVALLRAAKALDSVQAE-NEDQKHGIEIVRRAIEAPVRQIAENAGAEGSIIVGKLREKPEfGWGW 479
150396499 401 HATRAAVEEGILPGGGIALLRAVNALDGLKTA-NDDQRVGIEIVRRAIEAPVRQIAENAGAEGSIIVGKLREKVEfSYGW 479
190894865 401 HATRAAVEEGILPGGGVALLRAVKALENVQTA-NSDQRVGVDIVRRALEAPARQIAENAGAEGSVVVGKLREKTEfSYGW 479
27379746  401 SSTKAAVAEGIVPGGGLALLRAVAAVAKEEAAcEGDERTGVQILRRALEAPARQIAENSAADGGVVVARMLEGEG-SIGF 479
226944660 401 AATKAAIAEGIVPGGGLALLRAVPALLAEEARlEGDARTGLQILRRALETPVRTIAENSAVDDGVVVARLLGEEG-DIGF 479
227818754 401 HATRAAVEEGVLPGGGVALLRAVKALDRVQTE-NPDQRHGIEIVRRAIEAPVRQIAENAGAEGSIIVGKLREKTEfGYGW 479
227818822 401 HATRAAVEEGVLPGGGVALLRAVKALDSIRTE-NADQKHGIEIVRRALEAPVRQIAENAGAEGSIIVGKLREKTEfGFGW 479
86361060  480 NAQTGEFGDLYAQGVIDPAKVVRTALQDASSIAGLLVTTEAMIAEKPKkdaPPAMPAGAGM---DF 542
116249497 480 DAARNRYVDLLEEGIIDPTKVVRVALENAVSVASILLLTEATMTELPE---PIQQQVSPTM---EM 539
91783188  479 NAATGEYGDLVETGVVDPTKVTRTALQNAASIAGLILTTDATVAEAPKeekAVPAPAPE-L---EY 540
162139904 477 NAATGEYVDLIATGIIDPAKVTRSALQNAASIAGLFLTTEAVVANTPEyaeADAANVDAAMrsqGF 542
86741209  477 NAATGEYGEMAGFGVIDPVKVTRCALQSAASIAALLLTTETLVVEEVIgnpGAVIAPGFGDlaeGL 542
16264754  480 NAQTNEYGDLYAMGVIDPAKVVRTALQDAASVAGLLVTTEAMIAEKPKkeaAPALPAGGGM---DF 542
13472184  480 NAQTNAFGDLYNEGVIDPVKVVRTALQDAASVAGLLVTTEAMVAEKPKkepAVPAMPAGGM---DF 542
150396499 480 NAQTNEYGDLYTMGVIDPVKVVRTALQDAASVAGLLVTTEAMIAEKPKkesTPALPAGGGM---DF 542
190894865 480 NAQTGEFGDLYAQGVIDPAKVVRTALQDAASIAGLLVTTEAMVAEKPKkdaAPPLPPGAGM---DF 542
27379746  480 DASRKVYVDLVAAGIVDPVKVVRTALENAVSVASVLLLTEATMTEIPEpkrERLPEPDLAVq---- 541
226944660 480 DAAQNRYVDMFEAGIIDPTKVVRVALENAVSVASILLLTEATMTELPEpgpEEPRLPE-------- 537
227818754 480 NAQTNEFGDLFEQGVIDPVKVVRTALQDAASVAGLLITTEAMVAEKPKkeaPVPPMPPGGM---DF 542
227818822 480 NAQTNEFGDLYDQGVIDPVKVVRTALQDAASVAGLLITTEAMVAEKPKkdaPLPPMPGGGM---DF 542
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap