Conserved Protein Domain Family
PRK12820

?
PRK12820: PRK12820 
bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl-tRNA amidotransferase subunit C; Provisional
Statistics
?
PSSM-Id: 105955
View PSSM: PRK12820
Aligned: 2 rows
Threshold Bit Score: 1421.3
Threshold Setting Gi: 116750786
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
85858293   18 MDFSERVFCGHLTPDHTGRRVLLAGWVDAFRDHGGLLFIHLRDRNGIIQIVFSPEAASADVYRQAASLRAEYCVAVQGEV 97 
116750786   1 MAENDRSFCGNLSLSDVGSEVCLSGWVDALRDHGEVLFIHLRDRTGFIQAVFSPEHTPRRVYELASSLRSEFCVSLQGRV 80 
85858293   98 RKRLPGTENPHIETGDIEVFVSELTVLSESEALPFAISDKAMVAGASSAGADHVNEDLRMQYRYLDIRRPAMQKNLILRH 177
116750786  81 QRRTEETENPHIETGKIEVMVRELSILAASVVLPFPISEKAMTAGGGSGRADAVSEDLRLQYRYLDLRRPSMQDHLAKRY 160
85858293  178 RISQCVREFLDSRGFVEVETPVLTMSTPEGARDYLVPSRIHPRSFYALPQSPQLFKQLLMIGGMERYFQLARCFRDEDLR 257
116750786 161 RIIKRARDFLDTRGFLEIETPILTKSTPEGARDYLVPSRVHPKEFYALPQSPQLFKQLLMMAGFERYFQVVRCFRDEDLR 240
85858293  258 PNRQPEFTQLDIEASFIDEEFLYELIEELTVRMFAIGGIALSRPFPRMTYAEAMDTTGSDRPDLRFGLRMADVTGVFSRT 337
116750786 241 PNRQPEFTQLDMEASFIDEEFIFELTEELVARMFEVGGIELPRPFPRMPYGEAMETYGSDRPDTRFDLKFIEATDIFENT 320
85858293  338 SYSIFKQILQRGGSIKGINIKGQSEKLSKNVLQNEYAKEIAPSFGAKGMTWMRAEEGKLESNIVQFFSADELEALKRVFQ 417
116750786 321 RYGIFKQILQRGGRIKGINVSGQSEKLSKNVLQNEYAKEIVPSFGAKGMTWMRVSAGGLDSNIVQFFSEEEKGAVLRRFH 400
85858293  418 VEDGDVLIMVADPSCAIVNSALGQLRLHLGNRLGLIPEGVFYPVWITEFPLFEPTDEgGVTSSHHPFTAPDRTDFDPGNI 497
116750786 401 ARDGDVILMIADASHDLVLSALGQLRLHLADRLGLIPPGVFHPLWVTDFPLFEATED-GVTSSHHPFTAPDRESFDPLDL 479
85858293  498 EELLSLRSRAYDLVVNGEELGGGSIRINDREVQRRIFAALGLTEEDVKNKFGFFLRAFDFAAPPHGGLALGMDRVVSMIL 577
116750786 480 QGLLDLRSRAYDLVVNGEELGGGSMRINKKDIQLRIFRALGLSEQEIEDKFGFFVRALDYGAPPHGGIALGLDRVVSMIL 559
85858293  578 QTPSIREVIAFPKNRSAACPLTGAPSEVKREQLAELGLLNLGDKDVLPGDAEKEDRIDHLSWVSRIGIAEGERPVMESIL 657
116750786 560 RTPSIREVTAFPKNRSAYCPLTRAPSQVAQEQLRELGLTDMGEARQVRLLQERKELIDSLSWVSRIGFDEAERAAITTAL 639
85858293  658 AQAEELAAQVGDLAGNEEPVRSVAPVANRVREGLEAVRLSFSGTGRLLKNAPAVKGDYFKVAGILD 723
116750786 640 ADAVRMVETLEGIDCDFEPLFSPVSAVYRMGEKMGARECSLAATGEILKNAPSVKGNYYKVASILE 705
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap