Conserved Protein Domain Family
PRK12814

?
PRK12814: PRK12814 
putative NADPH-dependent glutamate synthase small subunit; Provisional
Statistics
?
PSSM-Id: 139246
View PSSM: PRK12814
Aligned: 9 rows
Threshold Bit Score: 1182.6
Threshold Setting Gi: 78187591
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
194333262   1 MATVSLTLNGKTITADAHVSILEAAKSNGVIIPTLCFHQELSALGSCWMCIVELKGKNRFVPACSTRVTSGMDIETDNPE 80 
193213391   5 MKPVNLIIDGRSVQAAPGQTILEAARENGIRIPTLCFHKEIEATGSCWICIVELKGKNRFIPSCSTKVSEGMVVETRNAE 84 
119356251   1 MNALTLTINGLKTTVQPGTSILDAAASCGITIPTLCFQQSLDVQGACWICIVEIKGKNRFVPACSTKVSAGMVIETETEE 80 
78188558    1 MTSISLTINNISVSVPQGSTILAAAEAAGVTIPTLCFLKELEERGACWMCIVEIKDKNRFVPACNTAAAEGMVIETENPT 80 
194335596   1 MKQLSLIIDQQAVTTAQGTSILEAAAEAGITIPTLCFLNSLHETGSCWMCIVEIKGKNRFVPACDTLASEGMVIETDNAE 80 
78187591    1 MNTISLIINGLPATAAPGTTILAAAADAGVTIPTLCHSERLESTGSCWMCIVELKGRNRFVPACSTAATDGMEIETENAD 80 
189345887   1 MNELTLAINGRTISATPGMSILQAAASAGIAIPTLCFDNTLESTGSCWMCIVEIKGKNRFVPACSTAVSGGMVIETENRE 80 
161485731   1 MKSVNLIIDGRSVQAAPGQTILEAARENGIRIPTLCFHKEIEATGSCWICIVEIKGKNRFIPSCSTKVSEGMVVETSNAE 80 
189499430   1 MSTITFTLNGKKKSAEKDLSILDACRNNGVSIPTFCFHQSLQALGSCWMCIVEIKGKHRFVPACSTRISEGMSVETDNAE 80 
194333262  81 LHAMRRKTLERLIDQHCGDCLGPCETACPAGCDIPGYTAAIARGDDREAIRIIKETVPLAASLGRICPAPCEDACRRHGV 160
193213391  85 LDAMRRQSLERLLAQHCGDCLAPCELACPAGCDIPGFVSAIAKGNDREALEIIRRTIPLPGILGRVCPAPCEEACRRHGV 164
119356251  81 LHMMRRRTLERLIEQHCGDCLGQCELACPAGCNIPGFISEIAAHHDDEAIAIIKNTIPLPGILGRVCPAPCEDACRRHGV 160
78188558   81 LSAMRRQNLERIIVEHSGDCNAPCELACPAGCNIPDFIAAIERGDNAKALEIIKEDIPLPAILGRICPAPCEEACRRHGV 160
194335596  81 ISAMRRQSLERIIEEHGGDCMGPCELSCPAGCNIPDFVAAIARHDEREAIRIIKQSIPLPGILGRICPAPCEDECRRHGV 160
78187591   81 LDKMRRESLQRILAQHTGDCQGPCETSCPAGCNIPGFIDAIAGGNDRLAIEIIKDSIPLPGMLGRICPAPCEEECRRNGV 160
189345887  81 LHAMRRQSLERIIDQHCGDCMGPCELSCPAGCNIPGFIAEIARQDYSEAIRIIKETIPLPGILGRVCPAPCENECRRHGV 160
161485731  81 LDAMRRQSLERLLARHCGDCLAPCELACPAGCDIPGFVSAIAKGNDREALEIIRRTIPLPGILGRVCPAPCEEACRRHGV 160
189499430  81 LFEIRKRNLERLLEGHCGDCDGPCEVSCPAGCDIPAFVSAIARGDDHEAIRIIKEDIPLPGILGRICPAPCEEECRRHGV 160
194333262 161 DDPVSICALKRFAADKDIASAEPfVPERKKASGKKVAVIGAGPAGLTAAYYLLRNGHDVTVFDANDTPGGMLYYGIPRFR 240
193213391 165 DEPVSICALKRFAADQEMTEGSE-LPEREPASGKRVAIVGAGPAGLTAAWFLLLGGHEVTILDANEKAGGMMRYGIPKFR 243
119356251 161 DDPVSICALKRYAADRDMEASERyIPAIAEKSGKHVAVIGAGPAGLTAAYYLLALGHEVTIYDEHPAAGGMMRYGIPRFR 240
78188558  161 DEPLSICALKRYAADRDSEQAERyLPPCEPSSGKHVAIVGAGPAGLSAAWFLLRKGHKVTIFEAAPQAGGVMRYGIPRFR 240
194335596 161 DQPVSICALKRYAADRDSAQPERfIPEIAPKTGKKVAIVGAGAAGLSAAWFLLSKGHGVTILESSEEAGGMLRYGIPRFR 240
78187591  161 DEPVSICALKRHAADLDTASTERfIPPPAPETGKKIAIIGSGPAGLSAAYYLRRMGHRVTLFEAEPQPGGMMRQAIPRFR 240
189345887 161 DEPVSICALKRYAADHDMESADRyIPEMRDKTGKTVAVIGAGPAGLTAAYYLLALGHDVTIFDANEAPGGMMRYGIPRFR 240
161485731 161 DEPVSICALKRFAADQDMVEGSG-LPERKPASGKRVAIVGAGPAGLTAAWYLLLDGHAVTVLDANEKAGGMMRYGIPKFR 239
189499430 161 DEPLSICALKRFAADRDNEASDRyIPSLSEKTGKKAAIIGAGPSGLTAAYYLLSEGHDVTVFDAHAQPGGMMRYGIPRFR 240
194333262 241 LPATILEADIAPLRAMGGEIVLNTVLGRDISLKELKKNgFDATYIAVGAAKASTMGIAGEELPGVVSGIGFLRDIASGKA 320
193213391 244 LPEAVIDADVEPLVKMGATFRFSTMFGKDAGLAGLQKE-HDAVLLTIGASQASKLGIPGEELDGVQSGIDFLADVADGTA 322
119356251 241 LPESVIDKDVEPLEQMGATFRFNTRFGKDISTASLQSA-FDAIFLAVGAQQAAAMHIPGEHETGVLSGIEFLRQANEGVA 319
78188558  241 LPESVIESDVAPLLAMGLELRCNTRFGRDVTFDNIRTQ-YDALLLAAGTEEAASMGIAGEELEGVISGITFLRNVALGTQ 319
194335596 241 LPETVIDSDIAPLLEMGLEFRFNTTFGQEVTLETLQAQ-FDAVFLAIGAQKASKMHIAGEDEPGVTSGIAFLRRVALDDQ 319
78187591  241 LPESVINSDIAPLEAMGVEFRCGTTFGRDVTIDELRKD-YDALLLAVGAQLSARLGIPGEDSPGVICGISFLKKAALGEK 319
189345887 241 LPEEVLDKEIEPLRLMGARFRMKTVFGKDITTASLQKE-FDALFLALGASKASLMGIPGEESPSVTSGIDFLHHAASGNA 319
161485731 240 LPEAVIDADVKPLVKMGAEFRFSTLFGKDANLEELQQE-HDAVLLTIGASQASKLGIPGEELDGVQSGIGFLANVADGKA 318
189499430 241 LPAEIIEADLAPLRAMGADFVCNTVLGRDISLEGLKNEgFDVVYLAFGAQKAAEMNIEGEKSEGVVSGIDFLKTVASGTM 320
194333262 321 VRTGKRVVVVGGGNTAVDAARTALRTGAESVTIIYRRTREEMPANQAEIEEALAEGIALQCLAAPSAITSCESGLEMTAL 400
193213391 323 TAPGKSVIVIGGGNTAIDAARTALRLGAEAVTILYRRGREEMPANRLEIEEAIAEGVELRLLAAPVAIEKGADGLVVTAV 402
119356251 320 EHPGANVVVVGGGNTAVDAARTALRLGATTVTILYRRTKEEMPANQQEINEAIAEGITLHVLALPVSMRRMNGFTEITAI 399
78188558  320 STLGSKVIVTGGGNTAIDAARTALRLGAEHVTILYRRSRADMPANASEIGEALAEGITLREWAAPLSIHAVNGALEMQAI 399
194335596 320 PHLEGRVVVTGGGNTAIDAARSAMRLGASTVTILYRRSRKEMPANASEIDEALSEGISLVEWAAPTAIRRLNDALEITAI 399
78187591  320 LEIGRKVLVAGGGNTAIDAARTALCLGAESVEIIYRRSTEDMSANRPEIREALGEGVRITPYTAPLSIESSDGRLVLTAL 399
189345887 320 IHPGKNVLVIGGGNTAVDAARTARRLGAEQVTILYRRTRNEMPANHAEIEEALSEGVALHVLAAPTSISTSEGSVTLTAV 399
161485731 319 AAPGKSVIVIGGGNTAIDAARTALRLGAESVTILYRRGREEMPANRLEIEEAVAEGVELRLLAAPVAIEKGANSLVVTAV 398
189499430 321 RSPGPKVVVIGGGNTAIDAARTALRLGAGSVRILYRRTIEEMPANRAEIQEALHEGVSIDFLTAPVSIQRDEGGIKLIVQ 400
194333262 401 KMLQGEPDESGRRRPVALNGSEFSLFADTIIAAIGQYVDPEIQTATGLQLSQKGTFKTDSATCMTEQEGVFAGGDCVIGA 480
193213391 403 EMQLGEPDASGRRRPVPVAGSEFTLQADTVISATGQQVDLPTEAASGIGTERNGTIKVNGGSMLTEAAGVFAAGDCVSGP 482
119356251 400 AMRQGEPDESGRKKPVPINGSEFTIAANTVISATGQQVDCSIAMAAGIGTSPEGTFDVNQATLQSNIAGIFSAGDCVTGP 479
78188558  400 AMQAGELDASGRRKPVPIAGSKFTLQANTIISAIGQQLNPALAEAAALTTTRNGLAVNPDTLQSTSDASLFACGDCVTGS 479
194335596 400 MMKPGAPDQSGRRRPVPVEGSEFTIMADTVISAIGQQIDRSVADHAGIGSTEHGEVLVHPETLQSARPWLFAGGDCVTGA 479
78187591  400 RMEAGAPDESGRRRPVPIEGSDFTITADTLITAIGQEIDPEVSRAAGLYPSHGLRMPVERGTLQSREGWIFAAGDCVTGA 479
189345887 400 IMQQGEPDESGRRKPVPVSGSEFTITCDTVISATGQQVECPKEDLDGVSISRNGTLAVDPQTLQSGVASIFAGGDCVTGA 479
161485731 399 EMQLGEPDASGRRRPVPVAGSEFTLHADTVISATGQQVDLPAEAAAGIGVERNGTVKINGESMLTGAAGVFAAGDCVSGP 478
189499430 401 KMKMGAPDQSGRARPVPVEHAAYALQADQVISAIGQQVDITILENPGIATAK-GTVVVDPETCRTSVPWVFAGGDCVTGP 479
194333262 481 DIAINAIEQGKRAADAIDSFLN-AVTSRNEKKPFNSTYGPRDNAPETFLMRAKPIKRASMQELQGPERTSTFREVALGLD 559
193213391 483 DLAIEAVRQGRLAAEAIDRFLNgGDPAATGTAMFNSTYGARDKAPHQFYDRARPAARIAVPELEAESRRRSFEEAVTGYD 562
119356251 480 DLAITAVSEGRRAAHSIHLFLQ-GKPVVGKPQQFNSSYGPRDQAPEAFYSKANPFEKIALPEISLLERSGTFREVVLGLS 558
78188558  480 DTAIRAVAQGKLAAHSIHSYLT-NQPVEAPTQPFNSSYGNREQAPKAFYAQKEAAPRVALPELPLSERQGNFHEVAIGYN 558
194335596 480 DTAIQAVEQGKRAAYAINLFLG-DEAVTVPKASFNSSYGARDEAPGAFYDKAEPAERVALAELLPTDRTNSFCEVVTGYT 558
78187591  480 DIAVKAVAAGKTAALSIERFLA-GKEPSSPVRPFNSSYGLRHEAPDALRANASAESRIPMQEIGHEMRTRGFEEIAKGYS 558
189345887 480 DIAIRAVEQGKRAAYFIDCFLL-GKTLKEEVVAFNSSYGPRDLAPASFYERVQTANRVPVPEIAPESRTGGFMEVVTGFS 558
161485731 479 DLAIKAVRQGRLAAEAIDRYLNgGDPAATGMSMFNSSYGARDKAPHQFYDRARPAARVAVPELEAESRRQSFEEAVTGYD 558
189499430 480 DTAINAVKQGKQAARAVHLYLK-GEPVTASPTLFNATYGPRDKAPEGFYRRTQPAPRAQLRELPLHLRTGGFEEVSAGLS 558
194333262 560 EEQARLEAQRCLRCSCTTKNNCSLRRLASRYEVSSAqCDVETHDNAYITRGNGIRFEREKCVDCGICVRTIEEYGPE-EL 638
193213391 563 PEQAREEAKRCLRCRCQAVDDCRLRNLATAFGVTTP-VVEETHEYFSIDRSGNIRFEREKCVDCGVCIRTMESISGDvAT 641
119356251 559 PEDAAQEALRCLQCRCNAIDNCRLRELAALYLPSGS-CKLEEKLDFEIISGTDIRIEREKCVDCGICVRTLEQYGTEhEP 637
78188558  559 NELARTEAARCLRCKCNAINNCRLRDLATHYLFGKV-EQHPEHLGFYKAANSAISMEREKCVDCGICVRLLEEH--NgNV 635
194335596 559 ETQAREEALRCLQCRCNAVNDCRLRVLASRYLPVEA-AQKHDHQGFYRAENADMGMEREKCVDCGICVRMLEEF--DgAI 635
78187591  559 PDEARREALRCMQCRCSDVDACRLRQLATLYRPDTP-PVETLHGGFSRQELGGIRVEREKCVDCGICIRTLQE---EgSS 634
189345887 559 ETDAATEAARCLQCRCKAIDTCRLRDLAARYLPDYT-CRQQEHPEFSISVTPHILIEREKCVDCGICVRTLEECRAEpTA 637
161485731 559 PEKAREEAKRCLRCRCQAVDDCRLRNLATAFGVATP-ATEEAHEYFSIDRSGDMRFEREKCIDCGICIRTLESASADaVT 637
189499430 559 QKSAREEALRCMRCSCTNSHDCTLRDLSSVYGVAQK-QKPVATEDFSITRNQEIRFEREKCVDCGICVRTLEETGKDgNE 637
194333262 639 RSTILIERCPTGALS 653
193213391 642 IQEELVEHCPTGAIS 656
119356251 638 DYQKLSTSCPTGALS 652
78188558  636 EIAVMRQSCPTGALS 650
194335596 636 DIAVMAESCPTGALS 650
78187591  635 RMEVIARNCPTGALS 649
189345887 638 DYRKLAASCPTGALS 652
161485731 638 IREELIDHCPTGAIS 652
189499430 638 ILRLLVERCPTGALS 652
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap