Conserved Protein Domain Family
flgD

?
PRK12812: flgD 
flagellar basal body rod modification protein; Reviewed
Statistics
?
PSSM-Id: 139245
View PSSM: PRK12812
Aligned: 8 rows
Threshold Bit Score: 335.305
Threshold Setting Gi: 57237056
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
153952103   2 ATTNWNSNLNWTNTTNTNQTSDKATKADNSSSSSSSGvvSNPNATLDKDAFLKLLLVELQHQDPTDPMDSDKMLTQTSQL 81 
57237056    1 MISSSDWNLNTTATTSGTTSSGSTSGTTRTDSSSSSGivSNPNATLDKDAFLKLLLIELQHQDPTDPMDSDKMLTQTSQL 80 
121613172   1 MISSSDWNLNTTATTSGTTSSGSTSGTTRTDSSSSSGivSNPNATLDKDAFLKLLLIELQHQDPTDPMDSDKMLTQTSQL 80 
118475635   2 AINSMNNTATPTGTQFTTDKWAAQTEAEKLNNASGTG--TNPYSQLDKDAFLKLLLVELQYQDPTEPMDSAKMLEQTSQL 79 
218561734   1 MISSSDWNLNTTATTSGTTSSGSTSGTTRTDSSSSSGivSNPNATLDKDAFLKLLLIELQHQDPTDPMDSDKMLTQTSQL 80 
157414367   1 MISSSDWNLNTAATTSGTTSSGSTSGTTRTDSSSSSGivSNPNATLDKDAFLKLLLIELQHQDPTDPMDSDKMLTQTSQL 80 
154174409   1 -----MTSVSDVTTKTTEARNAEKKAAAKQAATGTTG--ANPNSQLDKDAFMKLLLTELQYQDPTSPMDTEKMLTQTSQL 73 
157165774   1 -----MASVSDITTQTTQQKNAEKKANSRIDAAKGTG--TNPNSQLDKDAFMKLLLTELQHQDPTSPMDTEKMLTQTSQL 73 
153952103  82 SALEMQQNTNTTMQKMVETMQklsdsfsASMSTSALGAIGKMATVNENKVKLTGADEVIALKMYLPEDSDDKgiTLEVYD 161
57237056   81 SALEMQQNTNTTMQKMVETMQklsdsfsTSMSTSALGAIGKMATVSDNKIKLTGADELIALKMYLPEDSDENgvTLEIYD 160
121613172  81 SALEMQQNTNTTMQKMVETMQklsdsfsTSMSTSALGAIGKMATVSDNKIKLTGADELIALKMYLPEDSDENgvTLEIYD 160
118475635  80 ATLEMQENTNKVMKQLTTQMQ-------SSLSMTAMSALGKMANLS-NAVSKDTTTSSVDFSLYFPNDVKSG--SIQIYD 149
218561734  81 SALEMQQNTNTTMQKMVETMQklsdsfsTSMSTSALGAIGKMATVSDNKIKLTGADELIALKMYLPEDSDENgvTLEIYD 160
157414367  81 SALEMQQNTNTTMQKMVETMQklsdsfsTSMSTSALGAIGKMATVSDNKIKLTGADELIALKMYLPEDSDENgvTLEIYD 160
154174409  74 AALEMQENTNSTMRQLVAQLQ-------SNANAYAISALGKMVSTGSNAVNITDDTKEISSALYFKTDATKG--KLEIKN 144
157165774  74 ASVEMQENTNKAMKELVNQLK-------SNANAYAISALGKMVSTGSNAVTLTDEKKDAKFALYFKTDLANG--KIEVKN 144
153952103 162 KNNKLIfseKSNEGKEVSKGLFTLEWPGRNNDGVYAGDGEYTVKMVYNNKNGEKITANYGTYPIEGIKFVAGVAYAKMGG 241
57237056  161 SNNKLVf-sEKSDAKSISQGLFTMEWPGRNNDGVYAGDGEYTVKMVYNNKNGEKITANYGTYPIEGVVFKDGVAYAKMAG 239
121613172 161 SNNKLVf-sEKSDAKSISQGLFTMEWPGRNNDGVYAGDGEYTVKMVYNNKNGEKITANYGTYPIEGVVFKDGVAYAKMAG 239
118475635 150 SSENLV---KNIKFDELKSGINKFNWDGTDNNGDITLPGEYLIKATYTDTSGNSGESILGSYPVEAVKFVNGIAQIKIAG 226
218561734 161 SNNKLVf-sEKSDAKSISQGLFTMEWPGRNNDGVYAGDGEYTVKMVYNNKNGEKITANYGTYPIEGVVFKDGVAYAKMAG 239
157414367 161 SNNKLVf-sEKSDAKSISQGLFTMEWPGRNNDGVYAGDGEYTVKMVYNNKNGEKITANYGTYPIEGVVFKDGVAYAKMAG 239
154174409 145 ANSQVV---RTIEFKDVAAGVSKIGWDGKDDAGNQVPNGSYTIEAQYVDKNGKSYTTQVGQYPVEAVKFVDGKAQIRIAG 221
157165774 145 ANGQVV---RTTDLNETNAGVHNLAWDGKDASGNQVPNGSYTISATYTGKDGKEYKTQVGNYPVEAVKFVDGKAMMKVAG 221
153952103 242 QYVSFDDIGEISDYKLGLSSTSVGDSSSGDSSN 274
57237056  240 QEVPFDAIQEITDYKLGSSSSTGGSGSSGDSSG 272
121613172 240 QEVPFDAIQEITDYKLGSSSSTGGSGSSGDSSG 272
118475635 227 EYVSMDKIREFTEPVKTTAVNNSNDSSNSNDSE 259
218561734 240 QEVPFDAIQEITDYKLGSSSSTGGSGSSGDSSG 272
157414367 240 QEVPFDAIQEITDYKLGSSSSTGGSGSSGDSSG 272
154174409 222 EYVPMDKIAEFYEA------------------- 235
157165774 222 EYVSMDKVSEYYEG------------------- 235
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap