Conserved Protein Domain Family
PRK12807

?
PRK12807: PRK12807 
flagellin; Provisional
Statistics
?
PSSM-Id: 171737
View PSSM: PRK12807
Aligned: 7 rows
Threshold Bit Score: 321.771
Threshold Setting Gi: 49184597
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
49184597    1 MRINTNINSMRTQEYMRQNQDKMNVSMNRLSSGKRINSAADDAAGLAIATRMRARQSGLEKASQNTQDGMSLIRTAESAM 80 
30261766    1 MRINTNINSMRTQEYMRQNQDKMNVSMNRLSSGKRINSAADDAAGLAIATRMRARQSGLEKASQNTQDGMSLIRTAESAM 80 
47526996    1 MRINTNINSMRTQEYMRQNQDKMNVSMNRLSSGKRINSAADDAAGLAIATRMRARQSGLEKASQNTQDGMSLIRTAESAM 80 
229601291   1 MRINTNINSMRTQEYMRQNQDKMNVSMNRLSSGKRINSAADDAAGLAIATRMRARQSGLEKASQNTQDGMSLIRTAESAM 80 
227815468   1 MRINTNINSMRTQEYMRQNQDKMNVSMNRLSSGKRINSAADDAAGLAIATRMRARQSGLEKASQNTQDGMSLIRTAESAM 80 
218896694   1 MRINTNINSMRTQEYMRQNQAKMSNAMDRLSSGKRINSASDDAAGLAIATRMKAREGGLNVAGRNTQDGMSLIRTADSAL 80 
152975174   1 MRINTNINSMRTQEYMRQNQEKMNTSMNRLSSGKSINSAADDAAGLAIATRMRANEGGLNVASRNSQDGKSMIQTADSAL 80 
49184597   81 NSVSNILTRMRDIAVQSSNGTNTAENQSALQKEFAELQEQIDYIAKNTEFNDKNLLAGTGAVTIGSTSISGAEISIETLD 160
30261766   81 NSVSNILTRMRDIAVQSSNGTNTAENQSALQKEFAELQEQIDYIAKNTEFNDKNLLAGTGAVTIGSTSISGAEISIETLD 160
47526996   81 NSVSNILTRMRDIAVQSSNGTNTAENQSALQKEFAELQEQIDYIAKNTEFNDKNLLAGTGAVTIGSTSISGAEISIETLD 160
229601291  81 NSVSNILTRMRDIAVQSSNGTNTAENQSALQKEFAELQEQIDYIAKNTEFNDKNLLAGTGAVTIGSTSISGAEISIETLD 160
227815468  81 NSVSNILTRMRDIAVQSSNGTNTAENQSALQKEFAELQEQIDYIAKNTEFNDKNLLAGTGAVTIGSTSISGAEISIETLD 160
218896694  81 NSVSNILLRMRDLANQSANGTNTKGNQASLQKEFAQLTEQIDYIAKNTQFNDQQLLGT-----------ADKKIKIQTLD 149
152975174  81 NTVSNILLRMRDLAVQSANGTNSTTDRKALQKEFTQLTDQINYISKNTQFNGTDLMSD-----------SASTINIKSTD 149
49184597  161 SSATNQ-QITIKLANTTAEKLGID------ATTSNISISGAASALAAISALNTALNTVAGNRATLGATLNRLDRNVENLN 233
30261766  161 SSATNQ-QITIKLANTTAEKLGID------ATTSNISISGAASALAAISALNTALNTVAGNRATLGATLNRLDRNVENLN 233
47526996  161 SSATNQ-QITIKLANTTAEKLGID------ATTSNISISGAASALAAISALNTALNTVAGNRATLGATLNRLDRNVENLN 233
229601291 161 SSATNQ-QITIKLANTTAEKLGID------ATTSNISISGAASALAAISALNTALNTVAGNRATLGATLNRLDRNVENLN 233
227815468 161 SSATNQ-QITIKLANTTAEKLGID------ATTSNISISGAASALAAISALNTALNTVAGNRATLGATLNRLDRNVENLN 233
218896694 150 TGSTNPaQIEITLNSVKSADLGLDvqigdeGDAESTAAADPTSAKQAIDAIDAAITTVAGQRATLGATLNRFEFNANNLK 229
152975174 150 ASKAD--TINIELKTINASSLQIN----------NSKIESASDADTAISAIDKAINSIADHRATLGATLNRLDYNIENLN 217
49184597  234 NQATNMASAASQIEDADMAKEMSEMTKFKILNEAGISMLSQANQTPQMVSKLLQ 287
30261766  234 NQATNMASAASQIEDADMAKEMSEMTKFKILNEAGISMLSQANQTPQMVSKLLQ 287
47526996  234 NQATNMASAASQIEDADMAKEMSEMTKFKILNEAGISMLSQANQTPQMVSKLLQ 287
229601291 234 NQATNMASAASQIEDADMAKEMSEMTKFKILNEAGISMLSQANQTPQMVSKLLQ 287
227815468 234 NQATNMASAASQIEDADMAKEMSEMTKFKILNEAGISMLSQANQTPQMVSKLLQ 287
218896694 230 SQETSMADAASQIEDADMAKEMSEMTKFKILNEAGISMLSQANQTPQMVSKLLQ 283
152975174 218 NQATAMASSASQIEDADMAKEMSEMTKFKILSEAGVSMLSQANQTPQMVSKLLQ 271
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap