Conserved Protein Domain Family
PRK12802

?
PRK12802: PRK12802 
flagellin; Provisional
Statistics
?
PSSM-Id: 139237
View PSSM: PRK12802
Aligned: 12 rows
Threshold Bit Score: 266.744
Threshold Setting Gi: 115350212
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
104782830   1 MALTVNTNTTSLGVQKNLNRASDALSTSMTRLSSGLKINSAKDDAAGLQIATRMTSQIRGQTMAIKNANDGISIAQTAEG 80 
70729021    1 MALTVNTNVTSLNVQKNLNRASDALSTSMTRLSSGLKINSAKDDAAGLQIATRMTSQIRGQTMAIKNANDGISIAQTAEG 80 
115350212   1 -MLNINTNILSLTTQTNLSGSQSALSQAINRLSSGKRVNTAADDAAGLAISTTQTAAINALTQGVSNANNGISMIQTAAG 79 
170722866   1 MALTVNTNTTSLGVQKNLNKASDALSTSMTRLSSGLRINSAKDDAAGQQIANKLQTMVTGTTVAIKNANDGNSITQTAEG 80 
186477735   1 -MLNINTNIASLTAQNNLSGSQSALSQAINRLSSGKRVNTAADDAAGLAISTTQTASINALTQGAANANNGISMVQTTNG 79 
172059234   1 -MLNINTNILSLTTQTNLSGSQSALSQAINRLSSGKRVNTAADDAAGLAISTTQTAAINALTQGVANANNGISMIQTAAG 79 
78064820    1 -MLNINTNILSLTTQTNLSGSQSALSQAINRLSSGKRINTAADDAAGLAISTSQTAAINALTQGVANANNGISMIQTANG 79 
148546728   1 MALTVNTNTTSLGVQKNLNRASDALGTSMTRLSSGLKINSAKDDAAGLQIATRMTSQIRGQTMAIKNANDAISIAQTAEG 80 
77457754    1 MALTVNTNTTSLNVQKNLNRASDALSTSMQRLSSGLKINSAKDDAAGLQIATRMSSQIRGNTQAIQNANDGISVAQTAEG 80 
66046695    1 MALTVNTNVTSLSVQKNLSRASDALSTSMGRLSSGLKIMSSKDDAAGLNIATKINSQIKGQTMAIKNANDGMSIAQTAEG 80 
71733403    1 MALTVNTNVASLNVQKNLGRASDALSTSMTRLSSGLKINSAKDDAAGLQIATKITSQIRGQTMAIKNANDGMSLAQTAEG 80 
28869153    1 MALTVNTNVASLNVQKNLGRASDALSTSMTRLSSGLKINSAKDDAAGLQIATKITSQIRGQTMAIKNANDGMSLAQTAEG 80 
104782830  81 AMQEQTNILQRMRELALQSRNDSNSQTDRDALDKEFQSMLKEIDRIADSTQL-NGKNLLDGSAGAMTFQVGSNTGTANQI 159
70729021   81 AMQESTNILQRMRELAVQSRNDSNGTQDRVALNKEFAQMSDELTRIAKSTNL-NGKNLIDGSAGTMTFQVGSNTGSTNQI 159
115350212  80 ALQSTVDNLQRIRTLAVESGDGSLDSNARANLQAEVTTRLGEIDRVATQTTF-NGQTILSN-AGNVTFQVGASANQTVAV 157
170722866  81 ALSEITNILQRMRELALQARNDSNGTTERAALNKEFAAKSDEITRIATSTTFgTSKQLLNGTAGTMEFQVGAMTGTSQIL 160
186477735  80 ALQSIVDNLQRIRQLAVEAGDGSLDSNALANLQSEVSTRLTEITRVAQQTTF-NGQAVLNG-IGSVNFQIGAFNGQQITA 157
172059234  80 ALQSTVDNLQRIRTLAVESGDGSLDSNARANLQAEVTTRLGEIDRVATQTTF-NGQTILSN-AGNVTFQVGASANQTVAV 157
78064820   80 ALQSTVDNLQRIRTLAQQAGDGSLDSSARANLQAEVTTRLGEIDRVASQTTF-NSQTILGG-TGSVTFQIGAAANQVVTV 157
148546728  81 AMQEQTNILQRMRELAVQSRNDNNSEADRDALDKEFQSMLKEIDRIAGSTQL-NGKNLLDGSASDMTFQVGSNTGSDNQI 159
77457754   81 ALQASTDILQRMRELAVKARNGTNGTADQTATNAEFAQMSDEITRISAATNL-NGKNLLDGSAGTVTLQVGANTGSANHI 159
66046695   81 ALQESTNILQRMRELAVQSRNDSNSATDRVALNKEFTQMSSELTRIANSTNL-NGKNLIDGSASTMTFQVGSNSGASNQI 159
71733403   81 ALQESTNILQRMRELAVQSRNDSNSSTDRDALNKEFTAMSSELTRIAQSTNL-NGKNLLDGSASTMTFQVGSNSGASNQI 159
28869153   81 ALQESTNILQRMRELAVQSRNDSNSATDREALNKEFTAMSSELTRIAQSTNL-NGKNLLDGSASTMTFQVGSNSGASNQI 159
104782830 160 TITLSAAMKTTGTGAALTALagksITGANSTAAEATFSAAMDAIGSALDAINATRADLGANQNRLTSTINNLQNINENAE 239
70729021  160 TITLDSGFDAATLGVDSGTIn---ITGNDSTTAETNTKAAMDAIDKALATINSSRADLGAAQNRLTSTISNLQNINENAS 236
115350212 158 NFG-ATVWTSTGAGLSLSGL---------TVSDQTSAQSAITAIDTALKNVNTFQATLGAAQNTFQAAITTTQTQATNMS 227
170722866 161 SVSMTSSFAASTLAVGTGTLa---ISGTSDSAVHTSVDAAITAIDAALQTVDTKKSDLGAIQNRFQSTINNLQSMNENSA 237
186477735 158 NFG-SQKWDSGSLGVSGVSV-----------STASGAQAAMSTIDTVLTSVNTFQATLGATQNTFQAAISTTQTQATNMS 225
172059234 158 NFG-ATVWTSTGAGLSLSGL---------TVSDQTSAQSAITAIDTALKNVNTFQATLGAAQNTFQAAITTTQTQATNMS 227
78064820  158 DFG-TANWNSTGMSVNTLSV-----------ATQSGAQSAITAIDAALKQVNTFQATLGAAQNTFQAAISTTQTQATNMT 225
148546728 160 TISLSDAMNTTGALSGLSGQs---ITGADSAAAEATFTAALSAIDDALNAINSTRADLGAVQNRLTSTINNLQNINENAE 236
77457754  160 DLVLSGKFDAASLSVGSGTVv---LTGATSAAAASNIDNAITAIDAAIANINATRAALGASQNRLTSTISNLQNITENTT 236
66046695  160 SLSLSASFDANTLGVGSAIT----IVGSDSAAAETNFSASIAAIDSALQTINNTRSDLGAAQNRLSSTISNLQNINENAS 235
71733403  160 TLTLSASFDANTLGVGSAVT----IAGSDSTTAETNFSAAIAAIDSALQTINSTRADLGAAQNRLTSTISNLQNINENAS 235
28869153  160 SLTLSASFDANTLGVGSAIS----ITGADSATSEAAFSAAVAAIDSALQTINSTRADLGAAQNRLTSTISNLQNINENAS 235
104782830 240 AARGRVQDTDFAAETAQLTKQQTLQQASTSVLAQANQLPSAVLKLLG 286
70729021  237 AALGRVQDTDFAAETAQLTKQQTLQQASTAVLAQANQLPSAVLKLLQ 283
115350212 228 AARSQITDADFATETANLSKAQVLQQAGISVLAQANSLPQQVLKLLQ 274
170722866 238 AAMGRVQDTDFAAETAQLTKQQTLQQASTSVLAQANQLPSAVLKLLQ 284
186477735 226 AARSQITDADFATETANLSKAQVLQQAGISVLAQANSMPQQVLKLLQ 272
172059234 228 AARSQITDADFATETANLSKAQVLQQAGISVLAQANSLPQQVLKLLQ 274
78064820  226 AARSQITDADFATETANLSKAQVLQQAGISVLAQANSLPQQVLKLLG 272
148546728 237 AARGRVQDTDFAAETAQLTKQQTLQQASTSILAQANQLPSAVLKLLQ 283
77457754  237 AAQGRVQDTDFAAETANLTKQQTLQQASTSVLAQANQLPSAVLKLLQ 283
66046695  236 AALGRIQDTDFAAETAQLTKQQTLQQASTSILAQANQLPSAVLKLLQ 282
71733403  236 AALGRVQDTDFAAETAQLTKQQTLQQASTSVLAQANQLPSAVLKLLQ 282
28869153  236 AALGRVQDTDFAAETAQLTKQQTLQQASTSVLAQANQLPSAVLKLLQ 282
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap