Conserved Protein Domain Family
fliP

?
PRK12783: fliP 
flagellar biosynthesis protein FliP; Reviewed
Statistics
?
PSSM-Id: 171720
View PSSM: PRK12783
Aligned: 9 rows
Threshold Bit Score: 371.899
Threshold Setting Gi: 27381978
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
163850069   1 MKR----VRAILVtagLALAAGLTASAALAQGAapGGVTGVPGLDALLPPGNGAASGRIIQLVALLTVLSLAPGLLVMVT 76 
254559215   1 MKR----ARAILVtagLAVAAGLTASAALAQGAapGGVTGVPGLDALLPPGNGAASGRIIQLVALLTVLSLAPGLLVMVT 76 
170741215   1 MRRilpmTRALPAlacLALAGILALLA--AGPAaaQAASGLPSLDALLPPGNGAASGRIIQMVALLTVLSVAPGLLVMVT 78 
115523185   1 MKR----AP-------LVLFAVLLPTAALAQ---------IPDLSTLIPQGQGSASGRIIQMVALLTVLSLAPGLLIMVT 60 
90422616    1 MNR----ASAVPL---GVLAAALLPSAALAQ---------MPDLSTLIPPGGGSASGRIIQMVALLTVLSLAPGLLIMVT 64 
240137203   1 MKR----ARAILVpagLALAAGLTASAALAQGAapGGVTGVPGLDALLPPGNGAASGRIIQLVALLTVLSLAPGLLVMVT 76 
218528672   1 MKR----ARAILVtagLALAAGLTASAALAQGAapGGVTGVPGLDALLPPGNGAASGRIIQLVALLTVLSLAPGLLVMVT 76 
188579873   1 MIR----RLSL-----AAIVLGLTATAAVAQGA--GGVTGVPGLDALLPPGNGAASGRIIQLVALLTVLSLAPGLLVMMT 69 
27381978    1 -MK----LRVLL----LALILAVLPEMAFAQ---------IPDLNSLLPPGNGSTSGRIIQLMALITVLSVAPGLLIMVT 62 
163850069  77 SFTRFAVAFSFLRSGLGLQSTPANLFLVSLALFMTFYVMAPTFDRAWNEGVKPLQENRISEEEAFGKIVDPFREFMTQHV 156
254559215  77 SFTRFAVALSFLRSGLGLQSTPANLFLVSLALFMTFYVMAPTFDRAWNEGVKPLQENRISEEEAFGKIVDPFREFMTQHV 156
170741215  79 SFTRFVVALSFLRSGLGLQSTPANLFMVSLSLFMTFYVMAPTFDRAWQEGVRPLTENRISEEDAFGKVVDPFREFMQSHV 158
115523185  61 SFTRFVVALSFLRTGLGLQTTPANIVMISLALFLTFYVMAPTFDRAWREGIQPLMQNEITEKEAYARVTEPFREFMLAQV 140
90422616   65 SFTRFVVALSFLRTGLGLQTTPANIVMISLALFLTFYVMAPTFDRAWRDGLQPLMQNEITEKEAYSRVTEPFREFMLAHV 144
240137203  77 SFTRFAVAFSFLRSGLGLQSTPANLFLVSLALFMTFYVMAPTFDRAWNEGVKPLQENRISEEEAFGKIVDPFREFMTQHV 156
218528672  77 SFTRFAVAFSFLRSGLGLQSTPANLFLVSLALFMTFYVMAPTFDRAWNEGVKPLQENRISEEEAFGKIVDPFREFMTQHV 156
188579873  70 SFTRFAVAFSFLRSGLGLQSTPANLFLVSLALFMTFYVMAPTFDRAWNEGVKPLQENRIGEEEAFGKIVEPFREFMTQHV 149
27381978   63 SFTRFAVALSFLRSGLGLQTTPANLVLVSLALFMTFYVMAPTFDRAWETGVQPLMKNEISEEEAYLKITDPFREFMLAHV 142
163850069 157 RPKDLQTFTDLASRTFPKAEAGEKIDLRILIPAFMISELRRGFEIGFLIVLPFLVIDIIVSTIVMSMGMMMLPPTVISLP 236
254559215 157 RPKDLQTFTDLASRTFPKAEAGEKIDLRILIPAFMISELRRGFEIGFLIVLPFLVIDIIVSTIVMSMGMMMLPPTVISLP 236
170741215 159 REKDLQTFADLASRNFPKAEAGEKVDLRILIPAFMISELRRGFEIGFLIALPFLVIDMIVATVVMSMGMMMLPPTVISLP 238
115523185 141 RDKDLQTFENLAAESLRAKPDGERVDLRVIIPAFMVSELRRAFEIGFLIVMPFLVIDMIVATLTMSMGMMMMPPTVFALP 220
90422616  145 RDKDLQTFESLAAESLRIRPEGEKVDLRVIIPAFMVSELRRAFEIGFLIVMPFLVIDMVVATLTMSMGMMMMPPTVFALP 224
240137203 157 RPKDLQTFTDLASRTFPKAEAGEKIDLRILIPAFMISELRRGFEIGFLIVLPFLVIDIIVSTIVMSMGMMMLPPTVISLP 236
218528672 157 RPKDLQTFTDLASRTFPKAEAGEKIDLRILIPAFMISELRRGFEIGFLIVLPFLVIDIIVSTIVMSMGMMMLPPTVISLP 236
188579873 150 RPKDLQTFTDLASRNFPKAEAGEKIDLRILIPAFMISELRRGFEIGFLIVLPFLVIDIIVSTIVMSMGMMMLPPTVISLP 229
27381978  143 RDKDLQTFEALAAESFRKKFDDKRIDLRVIIPAFMISELRRSFEIGFLIMLPFLVIDMIVATLTMSMGMMMMPPTILALP 222
163850069 237 FKVLFFILIDGWNLLVSGLVRSFF 260
254559215 237 FKVLFFILIDGWNLLVSGLVRSFF 260
170741215 239 FKVLFFVLIDGWNLLVSGLVRSYF 262
115523185 221 FKVLFFVLIDGWNLLAVGLVRSFL 244
90422616  225 FKVLFFVLIDGWNLLAVGLVRSYL 248
240137203 237 FKVLFFILIDGWNLLVSGLVRSFF 260
218528672 237 FKVLFFILIDGWNLLVSGLVRSFF 260
188579873 230 FKVLFFILIDGWNLLVSGLVRSFF 253
27381978  223 FKMLFFVLIDGWNLLASGLVRSFS 246
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap