Conserved Protein Domain Family
flgC

?
PRK12782: flgC 
flagellar basal body rod protein FlgC; Reviewed
Statistics
?
PSSM-Id: 139220
View PSSM: PRK12782
Aligned: 15 rows
Threshold Bit Score: 234.657
Threshold Setting Gi: 163850061
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
163850061   1 MIDPLLSASRLASAGLEAQSLRMRVVSENLANAQSTGATPGADPYARKTVTFRAELDRAAGVASVRLREIGTDNAPFRTE 80 
188579865   1 MIDPLLSASRLASAGLEAQSLRMRVVSENLANAQSTGASPGADPYARKTVTFRAELDRAAGIASVRLREIGTDDAPFRTE 80 
153011526   2 SSDALQSTLKIAASGLSAQSTRLRIVSENIANAQSTAETADADPYRRKTVSFRTELEQGTGAAEVRIAEVGKDTSPFIEQ 81 
217976223   1 MIDPLEASLRVAGSGLEAQSARLRIVSENLANAQSTGSTPGADPYARKTITFASELDRASGVDLVRVKGIGADKAPFRVE 80 
115523177   1 MIDPLQASIQIASSGLEVQSTRLRVVSENLANANSTGRAPGAEPYRRKTTTFAAEMDRAQGVRVVKVKDVGVDRTPFRVE 80 
182680550   1 MIDPLKASMKIAGSGLEAQSTRLRVISENMANSESTGTTAGANPYQRKTVTFSSEMDRLSGLDLVQIKSIGKDTTPFQRE 80 
158422260   1 MIDPLKVAGQIAGSGLQVQAQRMRVVSENLANMRSTGSTPGADPYTRKTIQFQAELDRTLGASNVKVKSLGVDQAPFLTE 80 
90422608    1 MIDPLQASVQIASSGLEAQSTRLRVVSENLANANSTGRSPGAEPYQRKTTTFTAEMDRAAGVPVVKVKDIGVDRAPFRLD 80 
170741834   1 MIDPLTASARLASAGMEVQSLRLRVVAENIANAQSTGVDPGSDPYQRKTITFRSELDRAAGAATVGVREIGVDRAPFRVE 80 
27381986    1 MLDSLSASLTVASSGLEAQSTRMRIVSENLANATSTGRTAGADPYQRKTITFDAAMDRASGAQLAKVKEVGVDTTPYRVE 80 
163850061  81 HDPANAAADANGNVKLPNVNMLVEMADMREANRSYEANLQVIKQARAMVASVIDLLKS 138
188579865  81 HDPANPAADENGNVKLPNVNMLVEMADMREANRSYEANLQVIKQARAMVASVIDLLKS 138
153011526  82 YEPSHPAADERGYVRYPNVNMVVEMADMREANRSYEANLQVVKQARELISMTIDLLRS 139
217976223  81 QDPGNPAADSKGFVKLPNVNVIMEMADMREANRSYEANLQIVKQTRELSSMTVDLLRS 138
115523177  81 YEPSHPAADQDGYVKLPNVNTLIEMADMRETNRSYEANLQVVKQARSMVSMTIDMLRG 138
182680550  81 HDPGNPAADDKGFVKRPNVNILIEMADMREANRSYEANLQVLKQARDLSTMTIDLLRS 138
158422260  81 YDPGNPAADESGMVKLPNVNMLTEMADMREANRSYEANLQMIKQTRSMVAMTVDLLRT 138
90422608   81 YQPGHPAADQSGYVKLPNVNMLIEMADMRETNRTYEANLQVIKQTRSMVSMTIDLLRG 138
170741834  81 HEPGNPAADENGDVKYPNVNVLIEMTDMREANRSYEANLQMIKQARALVASVIDLLKS 138
27381986   81 YDPGHPAADKSGYVKLPNVNMMIEMADMREVNRSYEANLQVVKQVRSMLGMTIDLLRS 138
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap