Conserved Protein Domain Family
fliQ

?
PRK12781: fliQ 
flagellar biosynthetic protein FliQ
Statistics
?
PSSM-Id: 139219
View PSSM: PRK12781
Aligned: 6 rows
Threshold Bit Score: 99.5296
Threshold Setting Gi: 170744549
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
188579931  1 MNEVDALELVRSAIWTVLVAAGPSVGAAMLVGIAVALLQALTQVQEVTLTFVPKIVAILLVMLVTGTFVGSQIYAFAEMT 80 
170744549  1 MNEVDALELVRAAIWTILIGAGPAVAAAMAVGIAVALLQALTQIQEVTLTFVPKIVVILLVMLMTGSFVGTQLYMFTENA 80 
115523199  1 MNERDALDIAQQAVWTIIVASGPAVAAAMFVGIAIALLQALTQVQEMTLTFIPKIVVMLIVVAVSGSFMGAHIYAFTELL 80 
90422630   1 MNERDALDIVQQAIWTIIVVSGPAVGAAMAVGVAIALLQALTQVQEMTLTFIPKIVVMLIVVAVSGSFMGAHIYAFTELL 80 
170748119  1 MNEIDALELVRSAIWTIIVASGPAVGAAMVVGILIALFQALTQIQEVTLTFVPKIVVVLIVMIVTGSFVGGQIYAFTEMV 80 
27381963   1 MNERDALDIVQAAIWTIIVASGPAVGAAMLVGTIIALIQALTQIQEVTLTFVPKIIVILVVVAISGSFIGAHLSTFTEMV 80 
188579931 81 YGRIATGF 88 
170744549 81 YGRITSGF 88 
115523199 81 YSRIEHGF 88 
90422630  81 YSRIEHGF 88 
170748119 81 YGRIVSGF 88 
27381963  81 YSHIERGF 88 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap