Conserved Protein Domain Family
PRK12759

?
PRK12759: PRK12759 
bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional
Statistics
?
PSSM-Id: 139206
View PSSM: PRK12759
Aligned: 9 rows
Threshold Bit Score: 830.824
Threshold Setting Gi: 134301991
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
156502403   1 MVEVRIYTKTNCPFCDLAKSWFGANDIPFTQISLDDDIKRAEFYAEVNKNILLVEEHIRTIPQIFVGDIHIGGYDNLMAR 80 
89256330    1 MVEVRIYTKTNCPFCDLAKSWFGANDIPFTQISLDDDIKRAEFYAEVNKNILLVEEHIRTIPQIFVGDIHIGGYDNLMAR 80 
115314778   1 MVEVRIYTKTNCPFCDLAKSWFGANDIPFTQISLDDDIKRAEFYAEVNKNILLVEEHIRTIPQIFVGDIHIGGYDNLMAR 80 
56707665    1 MVEVRIYTKTNCPFCDLAKSWFGANDIPFTQISLDDDVKRAEFYAEVNKNILLVEEHIRTVPQIFVGDVHIGGYDNLMAR 80 
110670136   1 MVEVRIYTKTNCPFCDLAKSWFGANDIPFTQISLDDDVKRAEFYAEVNKNILLVEEHIRTVPQIFVGDVHIGGYDNLMAR 80 
167627842   1 MVEVKIYTKTNCPFCDLAKSWFGTNDIPFTQITLDDDQERLNFYAEVNKNILLVEEHIKSVPQIFIGDVPIGGYDNLMAR 80 
134301991   1 MVKVRIYTKTNCPFCDLAKSWFGANDIPFTQISLDDDVKRAEFYAEVNKNILLVEEHIRTVPQIFVGDVHIGGYDNLMAR 80 
118497575   1 MVEVRIYTKTNCPFCDLAKSWFGANDIPFTQISLDDDVKRAEFYAEVNKNILLVEEHIRTVPQIFVGDVHIGGYDNLMAR 80 
187931834   1 MVEVRIYTKTNCPFCDLAKSWFGANDIPFTQISLDDDVKRAEFYAEVNKNILLVEEHIRTVPQIFVGDVHIGGYDNLMAR 80 
156502403  81 AGEVIARVKGSSLTTFSKTYKPFNYPWAVDLTVKHEKAHWIEDEIDLSEDVTDWKNGKITKVEKEYITNILRLFTQSDVA 160
89256330   81 AGEVIARVKGSSLTTFSKTYKPFNYPWAVDLTVKHEKAHWIEDEIDLSEDVTDWKNGKITKVEKEYITNILRLFTQSDVA 160
115314778  81 AGEVIARVKGSSLTTFSKTYKPFNYPWAVDLTVKHEKAHWIEDEIDLSEDVTDWKNGKITKVEKEYITNILRLFTQSDVA 160
56707665   81 AGEVIARVKGSSLTTFSKTYKPFNYPWAVDLTVKHEKAHWIEDEIDLSEDVTDWKNGKITKVEKEYITNILRLFTQSDVA 160
110670136  81 AGEVIARVKGSSLTTFSKTYKPFNYPWAVDLTVKHEKAHWIEDEIDLSEDVTDWKNGKITKVEKEYITNILRLFTQSDVA 160
167627842  81 AGEVIARVKGSSLTTFSKTYKPFSYPWAVDLTVKHEKAHWIEDEIDLSEDVTDWKNGKITKVEKEYITNILRLFTQSDVA 160
134301991  81 AGEVIARVKGSSLTTFSKTYKPFNYPWAVDLTVKHEKAHWIEDEIDLSEDVTDWKNGKITKVEKEYITNILRLFTQSDVA 160
118497575  81 AGEVIARVKGSSLTTFSKTYKPFNYPWAVDLTVKHEKAHWIEDEIDLSEDVTDWKNGKITKVEKEYITNILRLFTQSDVA 160
187931834  81 AGEVIARVKGSSLTTFSKTYKPFNYPWAVDLTVKHEKAHWIEDEIDLSEDVTDWKNGKITKVEKEYITNILRLFTQSDVA 160
156502403 161 VGQNYYDQFIPLFKNNEIRNMLGSFAAREGIHQRAYALLNDTLGLPDSEYHAFLEYKAMTDKIDFMMDADPTTRRGLGLC 240
89256330  161 VGQNYYDQFIPLFKNNEIRNMLGSFAAREGIHQRAYALLNDTLGLPDSEYHAFLEYKAMTDKIDFMMDADPTTRRGLGLC 240
115314778 161 VGQNYYDQFIPLFKNNEIRNMLGSFAAREGIHQRAYALLNDTLGLPDSEYHAFLEYKAMTDKIDFMMDADPTTRRGLGLC 240
56707665  161 VGQNYYDQFIPLFKNNEIRNMLGSFAAREGIHQRAYALLNDTLGLPDSEYHAFLEYKAMTDKIDFMMDADPTTRRGLGLC 240
110670136 161 VGQNYYDQFIPLFKNNEIRNMLGSFAAREGIHQRAYALLNDTLGLPDSEYHAFLEYKAMTDKIDFMMDADPTTRRGLGLC 240
167627842 161 VGQNYYDQFIPLFKNNEVRNMLGSFAAREGIHQRAYALLNDTLGLPDSEYHAFLEYKAMTDKIDFMMDANPNTRRGLGLC 240
134301991 161 VGQNYYDQFIPLFKNNEIRNMLGSFAAREGIHQRAYALLNDTLGLPDSEYHAFLEYKAMTDKIDFMMDADPTTRRGLGLC 240
118497575 161 VGQNYYDQFIPLFKNNEIRNMLGSFAAREGIHQRAYALLNDTLGLPDSEYHAFLEYKAMTDKIDFMMDADPTTRRGLGLC 240
187931834 161 VGQNYYDQFIPLFKNNEIRNMLGSFAAREGIHQRAYALLNDTLGLPDSEYHAFLEYKAMTDKIDFMMDADPTTRRGLGLC 240
156502403 241 LAKTVFNEGVALFASFAMLLNFQRFGKMKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNEFKKEIYLMASKAV 320
89256330  241 LAKTVFNEGVALFASFAMLLNFQRFGKMKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNEFKKEIYLMASKAV 320
115314778 241 LAKTVFNEGVALFASFAMLLNFQRFGKMKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNEFKKEIYLMASKAV 320
56707665  241 LAKTVFNEGVALFASFAMLLNFQRFGKMKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNEFKKEIYLMASKAV 320
110670136 241 LAKTVFNEGVALFASFAMLLNFQRFGKMKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNEFKKEIYLMASKAV 320
167627842 241 LAKTVFNEGVALFASFAMLLNFQRFGKMKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNQFKKEIYLMASKAV 320
134301991 241 LAKTVFNEGVALFASFAMLLNFQRFGKMKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNEFKKEIYLMASKAV 320
118497575 241 LAKTVFNEGVALFASFAMLLNFQRFGKMKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNEFKKEIYLMASKAV 320
187931834 241 LAKTVFNEGVALFASFAMLLNFQRFGKMKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNEFKKEIYLMASKAV 320
156502403 321 ELEDRFIELAYELGTIEGLKADEVKQYIRHITDRRLNQLGLKEIYNIEKNPLTWLEWILNGADHTNFFENRVTEYEVAGL 400
89256330  321 ELEDRFIELAYELGTIEGLKADEVKQYIRHITDRRLNQLGLKEIYNIEKNPLTWLEWILNGADHTNFFENRVTEYEVAGL 400
115314778 321 ELEDRFIELAYELGTIEGLKADEVKQYIRHITDRRLNQLGLKEIYNIEKNPLTWLEWILNGADHTNFFENRVTEYEVAGL 400
56707665  321 ELEDRFIELAYELGTIEGLKADEVKQYIRHITDRRLNQLGLKEIYNIEKNPLTWLEWILNGADHTNFFENRVTEYEVAGL 400
110670136 321 ELEDRFIELAYELGTIEGLKADEVKQYIRHITDRRLNQLGLKEIYNIEKNPLTWLEWILNGADHTNFFENRVTEYEVAGL 400
167627842 321 ELEDKFIDLAYEIGTIEGLKADEVKEYIRHITDRRLNQLGLNEIYNIDKNPLTWLEWILNGADHTNFFENRVTEYEVAGL 400
134301991 321 ELEDRFIELAYELGTIEGLKADEVKQYIRHITDRRLNQLGLKEIYNIEKNPLTWLEWILNGADHTNFFENRVTEYEVAGL 400
118497575 321 ELEDKFIELAYELGTIEGLKADEVKQYIRHITDRRLNQLGLKEIYNIEKNPLTWLEWILNGADHTNFFENRVTEYEVAGL 400
187931834 321 ELEDRFIELAYELGTIEGLKADEVKQYIRHITDRRLNQLGLKEIYNIEKNPLTWLEWILNGADHTNFFENRVTEYEVAGL 400
156502403 401 TGSWDEAYSA 410
89256330  401 TGSWDEAYSA 410
115314778 401 TGSWDEAYSA 410
56707665  401 TGSWDEAYSA 410
110670136 401 TGSWDEAYSA 410
167627842 401 TGNWDEAYQH 410
134301991 401 TGSWDEAYSA 410
118497575 401 TGSWDEAYSA 410
187931834 401 TGSWDEAYSA 410
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap